SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003640 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000003640
Domain Number - Region: 59-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000956
Family APG12-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003640   Gene: ENSGACG00000002779   Transcript: ENSGACT00000003652
Sequence length 142
Comment pep:known_by_projection group:BROADS1:groupVI:1430932:1433600:1 gene:ENSGACG00000002779 transcript:ENSGACT00000003652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNFYKERGLAVPKTVVVSPPGPVVIKRQKKENLPQSVFTIPPELDVSLLLEFVGAEEGI
NNFKPLERRYVRVSGEATVRHVELFIRRKMELSATCQVDVVCGDQLLDHYQSLKDVQNSV
GEEALQDGLLVLHFGLVLPSKS
Download sequence
Identical sequences G3NE89
ENSGACP00000003640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]