SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003737 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003737
Domain Number 1 Region: 11-234
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-53
Family DBL homology domain (DH-domain) 0.000033
Further Details:      
 
Domain Number 2 Region: 220-361
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-34
Family Pleckstrin-homology domain (PH domain) 0.00052
Further Details:      
 
Domain Number 3 Region: 475-602
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-27
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 384-490
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.83e-27
Family DEP domain 0.0041
Further Details:      
 
Domain Number 5 Region: 674-740
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000381
Family PDZ domain 0.015
Further Details:      
 
Domain Number 6 Region: 575-671
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000276
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003737   Gene: ENSGACG00000002845   Transcript: ENSGACT00000003749
Sequence length 1613
Comment pep:known_by_projection group:BROADS1:groupXXI:7111029:7173655:-1 gene:ENSGACG00000002845 transcript:ENSGACT00000003749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESRSDHRAESGKDLEKQLRLRVCVLSELLKTERDYVGTLEFLSVFLHRLNQYAATKI
DKNITEETVKILFSNIEEILAVHKDFLSMVEELLQPDPHAHHEIGRCFLHFRTRFQIYDE
YGGNHEKAQRLLLELSKIRSVRTCLLNCMLLGGRKNTEVPLEGYLVAPIQRICKYPLLLR
ELLKRTPKKHHDYVLVQESLQVMKAVCSSINEAKRQMEKLEILEEWQSHIEGWEGSNITD
TCTEMLMHGVLLKISAGNIQERIFFLFDKLLVYCKKKNRRLKNSKTATEGPRYLFRGRIN
TEVMEVENVDDGTADYHSSGNIVNNGWKIHNTAKNKWFVCMAKTPEEKQEWLEAIMKERE
RRKSLTLGMEQDTWVMVSEKGEKLYHLMTKGHLIKDRKRKLTTFPKCFLGSEFVSWLMEI
GETGNPEEGVHLGQALVENGLIHHVTDKHQFKPEPVLYRFRYDDGTYHPRSDAHDVISKG
VRLFCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEALILGVELCDN
GFMHHVLEKSEFRDEPLLFRFFADEEMEGSNTKHKPMKHDLKIVENVISKSLLIRPSDGG
YGLLEERKRFPIIKSVEKCSPAEMAGLEVGRKLFAINGDLVFLRPFSEVEALLRQCFRSE
GPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAVAGLHPGQCIIKVN
GINVSKESHASVVAHVTACRKFRRPTQQDTIKWVYNNSESAQEDNQTTNEKPTPEENGDG
FECKVEEVMDKFNTIAIIDGRKDHVSLTVDNVQLEYGVMYEYDSTAGIKCHVLEKMVEPK
GFFSLTAKILEALARNDDTLVQMCSRLSSSCDVIPEGLQVRFSAMCAERVEHINRRITNY
RKFARVLKNRAWPTFKQAKAKVSPLHSSDFCPTNCHINVMEVSYPKTTTSLGSALGVQLD
NRKNTLEKGGRSSAQQGKLNPMVNVQHTITTMAAPSGHSLGRTEGHGLRFLLREEDLLTL
DSYQKLLHKLTMVVREMETHGGHIHDLLSSITLPPASEARTPESYISAESEAEKGERNGK
KVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSHCSSYVHSDEMDSGDE
LTASVWLSHDKQKKLHGFLEHLFSQVDSITSVLRGAVVARAFEQTKCFTPARGLQEFQEE
MEPKVSCTKKLRLHVKQDPWNLPSSVQSLTQIIAKYVEEVKTRLLLVLLQYTDSEIQLRR
DMVFSQSLVAAVCAFSEHLLAVLNQFNNAGRESDPRDLQDPQDLQEAQEASRRWLEQMAS
AGLLFHFQSLLSPNLTDEQAMLEDTQVALIDLEKVTFYFQQFEGEPLVANIPMSYQVEGT
RQALKVCFHLESFYFSQLPQRLKNGGGIKLYPVLFTQALESMEGYYYRDNVSVEEYQAQI
NAASLEKVKQYHKRLRAFYLDQSNMPPSSAPKAALVDKLMRPLNALEELYRLMESFISCR
RTAACQYTACGASGVGLLSVASELCSRLGEFEAVKYSQGIHACTLSVTLEQAILLARNHG
LPPRCIMQATDVMRKQGARVQNSAKNLGVRDRTPASVPRLYKLCQPPPQMVTH
Download sequence
Identical sequences G3NEI6
ENSGACP00000003737 69293.ENSGACP00000003737 ENSGACP00000003737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]