SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003744 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003744
Domain Number 1 Region: 344-450
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-23
Family PDZ domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 503-611
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.00027
Further Details:      
 
Domain Number 3 Region: 895-958
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-18
Family PDZ domain 0.00068
Further Details:      
 
Domain Number 4 Region: 32-88
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000201
Family Nucleotide and nucleoside kinases 0.0042
Further Details:      
 
Domain Number 5 Region: 243-281
Classification Level Classification E-value
Superfamily WW domain 0.00000000024
Family WW domain 0.0028
Further Details:      
 
Domain Number 6 Region: 1047-1088
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000578
Family PDZ domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003744   Gene: ENSGACG00000002852   Transcript: ENSGACT00000003756
Sequence length 1347
Comment pep:known_by_projection group:BROADS1:groupXII:764558:805765:1 gene:ENSGACG00000002852 transcript:ENSGACT00000003756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHKLNQDLKHYLSLRFQKSSPDHELQKTIRANLYRHAVPCTTRAPRDGEVPGVDYNFLSV
EDFLELEDSGTLLEIGTYDGNYYGTPKPPRQPVGGTVIAGHAGSQQSTPKRTKSYNDMQH
GRVVPADHDDDDQASEMNNSFTGEGRRPPRPPPPPLYPPPRRSVVFGGFFSPGTSEPRHL
PAKRGRGGRGEKYKIGAAASAQVHPCDPGIFLTSQIYTPCMSERRQRRGPFRKCKGEEGI
HTEELETDLELPPGWERIEDPVYGVYYVDHINRKTQYENPCGGGAASENPETARKRFLTS
AQRRERREEAVSSEWIEEHSSAAAPLANYAPNHLETYRDPQARGKPFFTRNPAELKGTFI
STKLKKSRRGFGFTVVGGDEPDEFLQIKSLVLDGPAAVDGKMETGDVIVSVNDTIVLGYT
HAQVVKIFQSIPIGSMVDLALCRGYPLPFDPDDPNTSLVTSVAIVDKEPIIVNGQEAFDS
PSSKAGPANGVREARSHSPSEAASNSSHGYSSDVVNLASSIATQPELITIHMEKGDKGFG
FTIADSLTGGGQRVKQIVDYPRCRGLREGDILMEVNKRNVQNMSHNQVVDLLSKCPRGSE
VTMLVQRGTLSTFRLRTMQQPLKLQPAHNRSIEAIANHVLRSRSPDTSEWQCVNVPPVEK
RHENQTSMSVRRCPKTPYGCEKRGRSLNNRKTPEGSAACFLSGVRQRPANSLLLCVSVPD
SQEQDIFLWRKDTGFGFRILGGNEPGEPECVGPSPPPSPPPSPKKISRGFLLYFVFAAFY
SGGDVELELLLSGASDRQLVKRGKGLTTIPLVTKEIKRSSPPLFAVPQKGRPPSESAPTL
AHEAAAHISRSTTYRSSIPPPDLRPDRSDGGGGGSEGSGQNKQTKLTQKAGNACVAMPHK
IGRIIEGSPADRCGKLKVGDRILSVNCCSITNKSHSDIVNLIKEAGNTVSLRIIPGDESS
NASLLTNAEKIATITTTHTPHQASESRFLGRILFKQPNVVCIHASFSTLKEQLTVQRSSA
PSARTHSGEGPGLICRVFLSGHVWRSRVGDEILEINGESTKNMMHSRAIELIKSGGRRAR
LVLKRGDGSVPEYDGGSDGHPPTPGAQNTPEVRTLPPNSRYHTSSESSYPPDLHKPSRQE
EAARGRDRERAGSDQMDYQGRQFNPHHHHTWNNNHSQSTLRQQSPDNTYNSGSGSNKKSR
GRKVKKSESESGISKLLKTLRKDSSGKKAAAAQKLRGREPSGSSSTLDGRFRQQRRGSLD
RSPAPKRAPSPDRRRAKSMDRRAERAPRDRTPEREPDDGGFLAATPERRFHERRLNAGHK
NNAGVRGANQLPEPKRRLYKESPDLSI
Download sequence
Identical sequences G3NEJ3
ENSGACP00000003744 69293.ENSGACP00000003744 ENSGACP00000003744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]