SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003751 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000003751
Domain Number - Region: 80-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0036
Family PHD domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003751   Gene: ENSGACG00000002866   Transcript: ENSGACT00000003764
Sequence length 344
Comment pep:known_by_projection group:BROADS1:groupXVI:7017961:7022290:-1 gene:ENSGACG00000002866 transcript:ENSGACT00000003764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFILHKKKEMDNRSKVECVLCQKCEETKVTGALSTKDEVTAHQNCLLFSSGLVCSSSPQ
FDDLFGFSVGDVLAEVKRGSKLMCSRCQLRGATAGCEVRRCKKSYHYPCAVQHKANVVED
ADKGKYVLYCSKHSEPTQNNKSSVNGRPSSVTGSQTVIKTINQSEAGPSKVGLMGISTVT
VRPSNSKRRLSFPDKQEGIPSKRTPKVLTDDSSNSDEPDKDMASFGPIETDSFEAEVNRN
GDESPDASTSGPPAVNRTMAGPKDDEDTILLSDAESESLLLPASPSSRSVPTLYPSVILL
GSEEEPARLSSEGSSPDLSSAGRPSPPRRVAVDATPPDTAGLPL
Download sequence
Identical sequences G3NEK0
ENSGACP00000003751 ENSGACP00000003751 69293.ENSGACP00000003751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]