SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003790 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003790
Domain Number 1 Region: 117-317
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-49
Family DBL homology domain (DH-domain) 0.000000032
Further Details:      
 
Domain Number 2 Region: 309-433
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-32
Family Pleckstrin-homology domain (PH domain) 0.0000233
Further Details:      
 
Domain Number 3 Region: 30-106
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-23
Family SH3-domain 0.0000782
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003790
Domain Number - Region: 615-670
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0602
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003790   Gene: ENSGACG00000002891   Transcript: ENSGACT00000003803
Sequence length 678
Comment pep:known_by_projection group:BROADS1:groupXVI:7166884:7185128:-1 gene:ENSGACG00000002891 transcript:ENSGACT00000003803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSFQIYQEPKNDGESLSNIKEFLKGCASFRVEDMSENSGQQLLVRARFNFLQNNEDELTF
DKGDLIGVIRQEEGGWWEGIINGRTGWFPSNYVREVKGSDKQVSPKSGTLKSPPKGFDTS
AISKTYYNLVLQNILETETEYSRDLQSLLTNYLRPLQSIDKLSSSDVALILGNLEEICTF
QQMLVQSLEECTKLPETQQRVAGFFLNLMPQMKALYVGYCSNHPSAVSLLTQHSEVLGEF
MEGRGAVPPGILTLTTGLSKPFMRLDKYPNLLKELERHMEESHPDRPDILKCMASFKNLS
AQCQEVRKRKELELQILSESIRLWEGDDIKTLGSVLYMSQVLVQSPGSEEKSERYLMLFP
HVLLMLSASPRMSGFIFQGKLPLASMSVTKLEDCEAHKNAFELNGTLFDRLQVVCTNQPD
LQDWVEHLTRQIRHTASIGPSHKPLTVPCHTLPTHPLTPSRHSEGRGMTVAPTYHTLPHP
SSHGTPHSTMMWGPLEPPNTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKSVKKLLPK
RKPERKQSEEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSRLQGESELLVIVPG
ERKILVEDPRRNGQSTIEEKSLVDVVYALREEVQELKQDNKKMKRSLEEEQRARKDLEKV
VKRVLKSMNDPTWDETNL
Download sequence
Identical sequences G3NEN9
ENSGACP00000003790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]