SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003887 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003887
Domain Number 1 Region: 457-513
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 1.44e-17
Family Rabenosyn-5 Rab-binding domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 157-201,257-283
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000144
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 
Domain Number 3 Region: 704-755
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.0000000000000288
Family Rabenosyn-5 Rab-binding domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003887   Gene: ENSGACG00000002965   Transcript: ENSGACT00000003901
Sequence length 759
Comment pep:known_by_projection group:BROADS1:groupXII:1073145:1077267:-1 gene:ENSGACG00000002965 transcript:ENSGACT00000003901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSYPTPFEGTGEVKEGFLCPLCLKDLQSFYQLQDHYEEEHSGDDGHVRGQLKSLVQKA
MKAKDKLLKRDGDERPDTGSYESFYYGGVDPYMWEPQELGATRSHLDLFKKHRAARIDHY
VIEVNKLIIRLEKLTSFDRINSDVAKIRAIEKSVVSWVSDSDVPFCPDCGNKFNIRNRRH
HCRLCGSIMCRRCMEFVPIPLAHKLINGTREALCVPGSPVQSQSPPAGVVCVGGGGMGSR
RGSISSLSSVTSMLEEKDDEKIRCCRHCMDTLLKRQQKLEEKDHMPDVVKLYERLRMCME
KVDEKAPEYIRMAESLNAGETTYNLDTAGGLRLEVQKYYELIDALSKKILTLGAKDEPPP
RPKALQLQRMIRYTATLFVQEKLLGLMSLPTKHKYEELKEKRKQEQEKRLQQERLQATQE
TLKRRQESEKNRPPAPPSTNGELPRAPRVTKVGGWLPSADGVHARAEHEDPLLQQIENIQ
SFLRQARDARRADEVAMLEENLRQLQDEYDQQQTSRAIALSQKLAAEESLQQGELERLEA
WEREERVAWEGPPDGGRQDDGEEEAGELTPTAEGSPSPARAESPALAGQEESPPRLRSLG
GHVTPPGGEGQNSASLNPFDDEEATPVEEDPSNPFFEDMKREHREVGGGREYNPFNEDDE
VKRGEAGNPFEDSDAEAGNPFLEGNSPVVSTNPFDGDEVAGDLPDVDVIEEELLLQQIDN
IRAYIFDAKLSGRLDEVELLSVNLRELQRTLQEQKKKKH
Download sequence
Identical sequences G3NEY6
ENSGACP00000003887 ENSGACP00000003887 69293.ENSGACP00000003887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]