SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003894 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003894
Domain Number 1 Region: 425-481
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 7.72e-18
Family Rabenosyn-5 Rab-binding domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 162-252
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.15e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003894   Gene: ENSGACG00000002965   Transcript: ENSGACT00000003908
Sequence length 490
Comment pep:known_by_projection group:BROADS1:groupXII:1073898:1076631:-1 gene:ENSGACG00000002965 transcript:ENSGACT00000003908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSYPTPFEGTGEVKEGFLCPLCLKDLQSFYQLQDHYEEEHSGDDGHVRGQLKSLVQKA
MKAKDKLLKRDGDERPDTGSYESFYYGGVDPYITPRADRRAAFLPLLRFVGATRSHLDLF
KKHRAARIDHYVIEVNKLIIRLEKECVLFLPLTAIEKSVVSWVSDSDVPFCPDCGNKFNI
RNRRHHCRLCGSIMCRRCMEFVPIPLARTRGSISSLSSVTSMLEEKDDEKIRCCRHCMDT
LLKRQQKLEEKDHMPDVVKLYERLRMCMEKVDEKAPEYIRMAESLNAGETTYNLDTAGGL
RLEVQKYYELIDALSKKILTLGAKDEPPPRPKALQLQRMIRYTATLFVQEKLLGLMSLPT
KHKYEELKEKRKQEQEKRLQQERLATQETLKRRQESEKNRPPAPPSTNGELPRAPRVTKV
GGWLPSADGVHARAEHEDPLLQQIENIQSFLRQARDARRADEVAMLEENLRQLQDEYDQQ
QTSRAIALSQ
Download sequence
Identical sequences G3NEZ3
ENSGACP00000003894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]