SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003950 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003950
Domain Number 1 Region: 74-327
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.02e-34
Family PhyH-like 0.087
Further Details:      
 
Domain Number 2 Region: 897-954
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.91e-22
Family Tudor domain 0.00012
Further Details:      
 
Domain Number 3 Region: 955-1010
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000331
Family Tudor domain 0.00015
Further Details:      
 
Domain Number 4 Region: 728-767
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000126
Family PHD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003950   Gene: ENSGACG00000003008   Transcript: ENSGACT00000003964
Sequence length 1063
Comment pep:known_by_projection group:BROADS1:groupVIII:547490:559593:1 gene:ENSGACG00000003008 transcript:ENSGACT00000003964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDTPAQSVGSRIMTFTPTKEEFKDFSRYIAYMESQGAHKAGMSKVIPPKDWKPRQTYN
DIDDLVIPAPIQQVVTGQSGLFTQYNIQKKPMTVLEFRKTSNMDKFCSPRYVDFDELERK
FWKNLTFNPPLYGADVSGTLYDPDVTEWNIGRLNTILDTVENESGIKIKGVNTPYLYFGM
WKSAFAWHTEDMDLYSINYLHFGEPKTWYSRYVVPPEHGKRLERLAKGFFPGNAQGCEAF
LRHKMTLISPSILKKFGIPFEKVTQEAGQFVVTFPFAYHAGFNHGFNCAESTNFATQRWI
DYGKQATLCSCRQDMVKISMDVFVRKFQPDRYKLWKAGKDNAAIDHSKVPPEAAELPREE
KSEPPKEAESKEPATPAPEDKSKNPPLKRLLNPKPQTGTKRQLQATEASGDIGVELPVKE
NEIEGVEPKKARLSRKDSPTKVKPDKGTVQSVKLLLPRWGLKGRLGYLEVGCIGNFTTHS
TGEAAKRYCTINNKPSLAGRPEGSQAKSPSKSSSKKTSSRQSASNTSPAHKLFQTTMSPA
DVLHVHSYAKGDYKAVGGDTHTHKCRSSTVAIVEPVTEGVSLQQVAEESAGEEDLSDLGQ
LPGHHPLIKDCLSDEEAPEEAPPAEEGGLEGESWAKPLAHLWQNRPPNLKKERVYNQCMG
SKAPYCSICTLFHTYQQTECASSVDSPVMLAGGRMRTKPLIPEMCFTTTTEEDSECDEQP
VTPHLEEDGTSLLISCSQCSIRVHTSCYGVDPASVSKEWKCVRCKANAMNENCCLCLLRG
GALQKANNNKWVHVLCAVAVLEARFVNITERSPVDLSGIPLQRFKLKCYYCKKRMKKASG
CCVQCSHGRCPTAYHPTCAQAAGVLMQPDEWPFVVHVTCCRHKGPTQIERNKAAMHELTV
GQKVICKHKNGRYYQCDVVQLSKETFYEVNFDDGSFSDNLFPEDIVSRDCAQLGPPPKGD
VVQVRWTDSLVYGAKFVAAHAIHMYLVEFEDGSQLTAKRDDVYALDEELPKRVKSRLSKA
SDMRFDGIFEGKEIIKQSKRQRVINSRYRGDYIEPVIYRAIME
Download sequence
Identical sequences G3NF49
ENSGACP00000003950 69293.ENSGACP00000003950 ENSGACP00000003950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]