SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003964 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003964
Domain Number 1 Region: 61-254
Classification Level Classification E-value
Superfamily Sec7 domain 8.9e-79
Family Sec7 domain 0.0000000101
Further Details:      
 
Domain Number 2 Region: 262-381
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-34
Family Pleckstrin-homology domain (PH domain) 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003964   Gene: ENSGACG00000002991   Transcript: ENSGACT00000003978
Sequence length 399
Comment pep:known_by_projection group:BROADS1:groupV:2216049:2226340:-1 gene:ENSGACG00000002991 transcript:ENSGACT00000003978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLKSEDGVVPDDLSPEERHELESIRRRKQELLHDIQRLKDDIAEVTNEIESLGLTEERK
SMQRNKQMAMGRKKFNMDPKKGIRFLIDSSLLKNTSNDIGQFLYKGEGLNKTAIGDYLGE
RDDFNIQVLHAFLELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFARRYCRCNPG
VFQSTDTCYVLSFAVIMLNTSLHNPNVKDKPSVQRFTAMNRGINDGGDLPEELLRNLYDS
IKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDK
EPRGIIPLENLNIREVDDSKKPNCFELFISDHKDQVIKACKTEADGRVVEGNHTFYRISA
PTAEEKDEWMNSIKAAISKDPFYEMLATRKKKVSSLKGL
Download sequence
Identical sequences G3NF63
69293.ENSGACP00000003964 ENSGACP00000003964 ENSGACP00000003964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]