SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003993 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003993
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-23
Family Ubiquitin-related 0.0000428
Further Details:      
 
Domain Number 2 Region: 269-333
Classification Level Classification E-value
Superfamily XPC-binding domain 1.28e-21
Family XPC-binding domain 0.0000571
Further Details:      
 
Domain Number 3 Region: 342-400
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000163
Family UBA domain 0.00044
Further Details:      
 
Domain Number 4 Region: 154-206
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000973
Family UBA domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003993   Gene: ENSGACG00000003046   Transcript: ENSGACT00000004007
Sequence length 402
Comment pep:known_by_projection group:BROADS1:groupVIII:727890:736429:-1 gene:ENSGACG00000003046 transcript:ENSGACT00000004007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTITLKTLQQQTFRIEIEPDMTVEALKEKIEKDRGKDAFPAAGQKLIYAGKILNNETTL
KEYKIDEKNFVVVMVTKPTPQPAAPAPQRAASATESAPQSAPQSAPQSAPQSAPQSAPQS
APQSASQSAPCSVAPRPATDDPAPAAVKDTVTTNWTPVSTVTDPAYESLVSEIMSMGYER
EHVVAALRASYNNPDRAVEYLLTGIPAEASDPPPQEPVGPSAPPDAPAPATQEPQQPPVA
SNQIKPIKSFAEPGSVSQPPSSGGGSVSTGNPLEFLRNQPPFQQMRQIIQQNPALLPALL
QQLGRDNPQLLQQITQHQERFVQMLNEPRAGDPAGHEAESEGQGSPPGTNYIQVTPQEKE
AIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQTWDDDE
Download sequence
Identical sequences G3NF91
ENSGACP00000003993 69293.ENSGACP00000003993 ENSGACP00000003993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]