SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003994 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003994
Domain Number 1 Region: 203-422
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-59
Family DBL homology domain (DH-domain) 0.000000091
Further Details:      
 
Domain Number 2 Region: 409-563
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-35
Family Pleckstrin-homology domain (PH domain) 0.00000804
Further Details:      
 
Domain Number 3 Region: 129-206
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-20
Family SH3-domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003994   Gene: ENSGACG00000003047   Transcript: ENSGACT00000004008
Sequence length 630
Comment pep:known_by_projection group:BROADS1:groupXXI:7497425:7501855:1 gene:ENSGACG00000003047 transcript:ENSGACT00000004008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGGTRQRPVSVIGGVEENEEKEDRLPSLLSRPPIPSHQVPPYRAVSARFRPSALSQSTPI
GLDRVGRRKLHRMLSGAAEGLSECSAALDDSVSEEEEGSFDELADATPYLQPGVELSVLN
EWISSGNAVHAEALWDHVTMEEQELAFKAGDVIRVLEASDKDWWWGRGADKESWFPSSFV
RVRVNQEDSSAESAESVADQEDPAPRDAHNAQHKEQMRTNVVQEIMNTERIYIKHLKDIC
EGYIRQCRKHPDMFTELQLKTIFSNIEDIYRFQRQFLRDLEKKYDKDQPHHSEIGSCFLL
QGEGFSIYSDYCNTHPAACAELQRLMKSGKYKHFFEACRLLQQMIDISIAGFLLTPVQKI
CKYPLQLGELLKYTPKDHSDYSGVSKAYEAMKNVASLINERKRRLESVDAIAHWQVAILH
WEGSDVLELSSDLIHSGELTRVVRQGKMQQRSFFLFDHQLVFCKKDVLRRDLLHYRGRLD
MDRTEVVDVPDGRDPDLGLQLRNALRLRNAATLEFVCGLCCKKAQDKQRWLQAFAKERHR
VREDREMAGMEISEEQRKQAILNARRAKQKKSKIHHVDIGVPPHHQNLHPIHQRHITIPT
SVPQQQVFSLAEPPKRKPYHLLQSITFFRK
Download sequence
Identical sequences G3NF92
ENSGACP00000003994 69293.ENSGACP00000003994 ENSGACP00000003994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]