SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004083 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004083
Domain Number 1 Region: 395-762
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.02e-112
Family Oxysterol-binding protein 0.0000339
Further Details:      
 
Domain Number 2 Region: 63-186
Classification Level Classification E-value
Superfamily PH domain-like 8.92e-22
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004083   Gene: ENSGACG00000003120   Transcript: ENSGACT00000004097
Sequence length 763
Comment pep:known_by_projection group:BROADS1:groupX:3827284:3869718:1 gene:ENSGACG00000003120 transcript:ENSGACT00000004097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSAAPHPVDSAANSSPSDRGSSSSTRKPGRSGSHSPGSGSLGGPGGGGGGSSRGAVLGNS
MNLQQPRKRQLEGVLSKYTNLIQGWQNRYFVLDPEVGQLQYFVNDQGRSQKPRGSLPLIG
ASVTTSDEAPHMFVVNSVNGELYKLRASDAKEQQFWITQLQACARRHSDSSAKGSSSSGR
TRSFSLLPHLTPSSSPGPQRNLSHVASPSNIVTITHHKSPAAARRAKNLYPGRLLEVKEV
MSQAEGQQKNLVQSIDSLPTRGPLSCLDQDLLLLKATSAATLSCLGECLNILQRTQSHGQ
GPPQCPKSSDGVPVWTVPKSPSGEQLKNGVLTPLRSAEPSPDFRRRSLSHGAESLRITTN
YPSPHHLPGLEDIDPTEEVTDTEDNDEEDLGVLDDQRSVILHLLSQLKLGMDLTRVVLPT
FILEKRSLLEMYANFMAHPDMFLSITAGATAEDRIVRFVEYYLTAFHEGRKGAVAKKPYN
PVLGETFHCSWEVPRDKVRPPVRSGQGSSGNAQQAEDSPAECYRVRFVAEQVSHHPPVSG
FYCECREKNMCVSAHVWTKSKFMGMSIGVSMVGEGVLCLLEHDEEYVFTLPCAYARSILT
VPWVELGGKVSINCVKSGYSATVTFQTKPFYGGKVHRVTAEVKHNPTNTIVCKAQGEWNG
TLEFTYSSGETKVIDTAKLPVTRKELRPVEKQGRTESRRLWQHVTKSLKEGNMDEATENK
HRLEERQRGEERQRAADNQPWTPKYFTKEGDSWIYSSPLWKST
Download sequence
Identical sequences G3NFI1
ENSGACP00000004083 ENSGACP00000004083 69293.ENSGACP00000004083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]