SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004087 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004087
Domain Number 1 Region: 6-48
Classification Level Classification E-value
Superfamily UBA-like 0.00000000138
Family TAP-C domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004087   Gene: ENSGACG00000003116   Transcript: ENSGACT00000004101
Sequence length 260
Comment pep:known_by_projection group:BROADS1:groupXVI:7513309:7515102:1 gene:ENSGACG00000003116 transcript:ENSGACT00000004101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHKLKSSQRDKVRQFMSFTQAGEKTAVYCLTQNDWKLEVATDNYFQNPDLYCKESMKTS
VDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLSLDPASISVLVVAWKFRAATQCEFTK
KEFLDGMTELGCDSPEKLKALLPRLEQELKDSGKFKDFYQFTFNFAKNPGQKGLDLEMAV
AYWNLVLSGRFKFLDLWNRFLLEHHKRSIPKDTWNLLLDFGSMIADDMDNYDEEGAWPVL
IDDFVEFARPIVTGSKRKTL
Download sequence
Identical sequences G3NFI5
ENSGACP00000004087 ENSGACP00000004087 69293.ENSGACP00000004087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]