SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004174 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004174
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-23
Family Ubiquitin-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004174   Gene: ENSGACG00000003183   Transcript: ENSGACT00000004188
Sequence length 382
Comment pep:known_by_projection group:BROADS1:groupX:4293947:4298804:-1 gene:ENSGACG00000003183 transcript:ENSGACT00000004188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQGIVDSSVTLVIRAPNQKYSDHTINCCHNWTVEKLKAHISDVYPSKPSSKDQRLVYSG
KLLLDHFTLKDVLRKQDEYHMLHLVCAARTPPTSPKPLRSHSNKPQEGSAGPPPLLNPAG
PTTGQHGPPAESSDGLRQRTGPFPYHQMYPQFMQSWDQYSSPSIPPTNMPTHVNPMTLMW
WQQLYARQYYMHYQLLAASSQHLRPDQPAAHSNQPDPLSQRPQADRRGNPEVQMNAQGGE
IMNEEEQHRDWLDWVYTFSRAGVLLSIVYFYSSFSRFVMVMMAMVVLYLHQTGWFPFNLE
NELQLPGDRDHQDDLEGELQNQDLQEMEGVMDDGSDDDGESGEEGAEDPNSAPNAGFLSS
TWSFIITFFMSLIPEGPPNAAN
Download sequence
Identical sequences G3NFR9
ENSGACP00000004174 69293.ENSGACP00000004174 ENSGACP00000004174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]