SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004271 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004271
Domain Number 1 Region: 354-515
Classification Level Classification E-value
Superfamily PH domain-like 7.26e-45
Family Phosphotyrosine-binding domain (PTB) 0.003
Further Details:      
 
Domain Number 2 Region: 139-206
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000216
Family SAM (sterile alpha motif) domain 0.0066
Further Details:      
 
Domain Number 3 Region: 215-273
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000766
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004271   Gene: ENSGACG00000003255   Transcript: ENSGACT00000004285
Sequence length 581
Comment pep:known_by_projection group:BROADS1:groupXII:1658205:1677946:-1 gene:ENSGACG00000003255 transcript:ENSGACT00000004285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANLTDCDPKAIYATVNKEPRESGAAAASSIRMRPPGDLKLARSLSKSDSDLLVSPPSE
EDGGLGNRSESVSNCSAGKKRLEKSPSFTSEWDEKRTTPSTTNLRRSNSFDSIEKIMTLI
GAGIDFSRDQQYAAPGAAGRLLEQPVGDWLEHVGLPQYESKLLLNGFDDLHYMGNNVMED
QDLREIGITDPSHRKKILHASRSLPKVKALGCDGSSSLSSWLDNLGLHEYLHNFLTSGYR
TLDCVKNLWELEIVNVLKISLLGHRKRIIASLAERPYEEPPVKPPRLSQIRCQDLPGSQT
SSPLSHMESYTGRSMDPLLPAGEAGRKKVPDNDYDVAQRHRGEQHRSHERHEDRHREPRL
TLRPPSLAAPYAPVQNWHHQPEKLIFECCAYEASYLGSMLIKELRGTESTQDACAKMRRS
TEQMRKVPTIVLSITYKGVKFIDAANKNIIAEHEIRNISCAAQDPEDLCTFAYITKDLQT
SHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQRTKQHQNLPLGPGSEASRPVPK
PRGSVRKSASDIAEPEGDSQSGGGAAWLADPKESKRTISTK
Download sequence
Identical sequences G3NG16
ENSGACP00000004271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]