SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004273 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004273
Domain Number 1 Region: 303-464
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-45
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 
Domain Number 2 Region: 88-155
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000019
Family SAM (sterile alpha motif) domain 0.0066
Further Details:      
 
Domain Number 3 Region: 164-222
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000668
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004273   Gene: ENSGACG00000003255   Transcript: ENSGACT00000004287
Sequence length 530
Comment pep:known_by_projection group:BROADS1:groupXII:1658205:1676555:-1 gene:ENSGACG00000003255 transcript:ENSGACT00000004287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPGDLKLARSLSKSDSDLLVSPPSEEDGGLGNRSESVSNCSAGKKRLEKSPSFTSEWD
EIEKIMTLIGAGIDFSRDQQYAAPGAAGRLLEQPVGDWLEHVGLPQYESKLLLNGFDDLH
YMGNNVMEDQDLREIGITDPSHRKKILHASRSLPKVKALGCDGSSSLSSWLDNLGLHEYL
HNFLTSGYRTLDCVKNLWELEIVNVLKISLLGHRKRIIASLAERPYEEPPVKPPRLSQIR
CQDLPGSQTSSPLSHMESYTGRSMDPLLPAGEAGRKKVPDNDYDVAQRHRGEQHRSHERH
EDRHREPRLTLRPPSLAAPYAPVQNWHHQPEKLIFECCAYEASYLGSMLIKELRGTESTQ
DACAKMRRSTEQMRKVPTIVLSITYKGVKFIDAANKNIIAEHEIRNISCAAQDPEDLCTF
AYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQRTKQHQNLPLGPG
SEASRPVPKPRGSVRKSASDIAEPEGDSQSGGGAAWLADPKESKRTISTK
Download sequence
Identical sequences G3NG18
ENSGACP00000004273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]