SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004282 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004282
Domain Number 1 Region: 890-1051
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-44
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 
Domain Number 2 Region: 7-25,89-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-43
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 695-762
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000511
Family SAM (sterile alpha motif) domain 0.0066
Further Details:      
 
Domain Number 4 Region: 771-829
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000179
Family SAM (sterile alpha motif) domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004282   Gene: ENSGACG00000003255   Transcript: ENSGACT00000004296
Sequence length 1109
Comment pep:known_by_projection group:BROADS1:groupXII:1658229:1695163:-1 gene:ENSGACG00000003255 transcript:ENSGACT00000004296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEQELLEAARTGNLAAVEKLLSGKRQSAGTGGGSSGTGGSGASGGHGASSHPLSSLLS
VNKGMSLGCSARSVYSPCLCSSDGFHRGCGSRCSENEALPNIAASKGCYPLHLPAWKGEE
QFVKLFFPQGPLPPPLNEQSSVDHKEFKRCGPFDPYINAKNNDNETPLHCAAQYGHSQVV
RLLLEELTDPTMRNNKFETPLDLAALYGRLEVVKQLLSAHPNLLGCNTKKHTPLHLASRN
GHLPVVEVLLDAGMDINYETEKGSALHEAALYGKTEVVQRLLAAGVGVNIVDQRGLSALD
TVQGMPSQKSREIAALILGEGRVRTPCQVPPPLFASRSPSPPRVVGEMEKVSELISGLAP
GPEEESPYEALFEATSCHSLDSLTQRQVLRSRLGTAAEGTSRLKLAPITGVPPARVNPLP
QTTSDPRARRGTRCSFLGGGARSEQREEAEQPFAVDHQGGGIDILCLQNKHDVISKARSQ
RKTRAVTSPADLHSLTPYNTHTHTRGSCFSLENEGNVSPAPLGGISESSHSGVFVVSCED
QEAGVPEQFTGLLHGSSPVFDSREEPFNCDPKAIYATVNKEPRESGAAAASSIRMRPPGD
LKLARSLSKSDSDLLVSPPSEEDGGLGNRSESVSNCSAGKKRLEKSPSFTSEWDEQIVWA
SRASSTDGIEKIMTLIGAGIDFSRDQQYAAPGAAGRLLEQPVGDWLEHVGLPQYESKLLL
NGFDDLHYMGNNVMEDQDLREIGITDPSHRKKILHASRSLPKVKALGCDGSSSLSSWLDN
LGLHEYLHNFLTSGYRTLDCVKNLWELEIVNVLKISLLGHRKRIIASLAERPYEEPPVKP
PRLSQIRCQDLPGSQTSSPLSHMESYTGRSMDPLLPAGEAGRKKERHEDRHREPRLTLRP
PSLAAPYAPVQNWHHQPEKLIFECCAYEASYLGSMLIKELRGTESTQDACAKMRRSTEQM
RKVPTIVLSITYKGVKFIDAANKNIIAEHEIRNISCAAQDPEDLCTFAYITKDLQTSHHY
CHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQRTKQHQNLPLGPGSEASRPVPKPRGS
VRKSASDIAEPEGDSQSGGGAAWLADPKE
Download sequence
Identical sequences G3NG27
ENSGACP00000004282 69293.ENSGACP00000004282 ENSGACP00000004282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]