SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004311 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004311
Domain Number 1 Region: 23-64
Classification Level Classification E-value
Superfamily UBA-like 0.000025
Family TAP-C domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004311   Gene: ENSGACG00000003293   Transcript: ENSGACT00000004325
Sequence length 290
Comment pep:known_by_projection group:BROADS1:groupXII:1713331:1717266:1 gene:ENSGACG00000003293 transcript:ENSGACT00000004325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGMDLDLDQDLVQKFSCMGTTDKDILISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNISAPCMSFVSDVTIGEGESVPPDTHFTKTWRVQNTGSESWPPGVCLKYVGG
DQFGHVNMVMVRSLDPQEIADVSVQMQSPASPGMYQGQWRMATATGLYYGDVIWVILSVE
VGGLLGVTQQLSSFQAEFNTQPHRRLEGDYNPFASPEKSKCPNGNNNSLHDASVHRVAEE
HWQGSPDQLQQDQNGLSQNSVDLVANSLQSNLSVVSYNQGMQEPYPFGHS
Download sequence
Identical sequences G3NG56
ENSGACP00000004311 69293.ENSGACP00000004311 ENSGACP00000004311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]