SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004356 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004356
Domain Number 1 Region: 43-78
Classification Level Classification E-value
Superfamily WW domain 0.000000238
Family WW domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004356
Domain Number - Region: 305-350
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0011
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004356   Gene: ENSGACG00000003325   Transcript: ENSGACT00000004370
Sequence length 670
Comment pep:known_by_projection group:BROADS1:groupXVII:520341:526271:-1 gene:ENSGACG00000003325 transcript:ENSGACT00000004370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNDSQGLVKGEAAVRAPPPLGSASSQGPPLSPSSTSKPPELPDELVQAGWAKCWSRREN
RPYYFNRFTNQSLWEVPVLGQHDVISDPLGLNAAPAEGGGCVPGNGQRKRRISEEQGAGP
NSIKRVKVEPTTPISPSTAGVKPWNSTTEEKPAQPATPTTPSPAPAVYRPAFIYWDLDLQ
TNAVIREHPPDNNLLPPHPEIELQRAQLVTKLRQHYHELCHQREGIDPPRESFNRWLLER
KLIDKGHDPLLPSDCEPVISPSMFREIMNDIPIRLARIKYKEEARRLLFRYAEAAKRMID
SRNASPDRRKVVKWNAEDTMNWLRRDHSASKEDYMDRLEHLREQCGPHLTAVAKDSVEAI
CSKIYQLSAEYSRRLRQTHLSLLQDPPTGSEASASPQQSRLVYCYPVRLALPSPLLPRVE
LHFENDMACLRFKGEMVKVNRGHFSKLELLYRYSCIDDTRFEKFLSRVWCLLKRYQVMFG
SGANEGTGLQGALPVSVFEALIRQFGVSFECFASPLNCYFKQFGSAFPDIDSFFGSRGPF
LSFRPVSGSFEANPPFCEELMDAMVAHFEELLDKSSEPLSFIVFVPEWRNPVTPALTRME
ASRFLRHQLNVPAYEHEYRSGSQHICKRDELYYRAVHGTAVLFLQNDAGFAKWAPTPERL
AELLAAYRPS
Download sequence
Identical sequences G3NGA1
ENSGACP00000004356 ENSGACP00000004356 69293.ENSGACP00000004356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]