SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004421 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004421
Domain Number 1 Region: 16-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000346
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004421
Domain Number - Region: 116-246
Classification Level Classification E-value
Superfamily t-snare proteins 0.00785
Family t-snare proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004421   Gene: ENSGACG00000003382   Transcript: ENSGACT00000004435
Sequence length 337
Comment pep:known_by_projection group:BROADS1:groupXIX:3673549:3674727:-1 gene:ENSGACG00000003382 transcript:ENSGACT00000004435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDQNLQQGASAAMLSGSPQSYCVVEKWRGFERILPNKTKVLRLWGAWGDEQENVRFVLVK
NEASLPNNGPRSAEARVVQSRESGSPGGGLKGTARTCWTAAATAANLSQEKQRRIVRKAF
RKLDKMNKKKEQTVSKDKGSAEKMETLVHLVISQDHTIRQQLQRIKELDREIERYEAKVH
FDRIKRHGVNYVQDTYMVDSFSSSSSSETPAPSDCKRQDARPTAEAVAQFQDYARRCEEV
VRLQEELTEREALVECITGEIQEELNRRWMKRRRSEREADAAKDAGGITEEMRAAVTSAA
PAAGPDVESFSEDEFTLEEADSTLKGEGGGEPGPAGA
Download sequence
Identical sequences G3NGG5
ENSGACP00000004421 69293.ENSGACP00000004421 ENSGACP00000004421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]