SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004444 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004444
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily EF-hand 1.83e-24
Family S100 proteins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004444   Gene: ENSGACG00000003398   Transcript: ENSGACT00000004458
Sequence length 92
Comment pep:known_by_projection group:BROADS1:groupX:4606778:4608348:-1 gene:ENSGACG00000003398 transcript:ENSGACT00000004458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDIQKAMALLIGVFDKYAGKEGDKHTLTKGELKELLQNEFGDLLGKTNDQAAVDRIFKG
LDSNQDNSVDFNEFSNMVSCLTVLCHEHFCKK
Download sequence
Identical sequences G3NGI8
ENSGACP00000004444 69293.ENSGACP00000004444 ENSGACP00000004444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]