SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004512 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004512
Domain Number 1 Region: 300-407
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.15e-45
Family ets domain 0.0000026
Further Details:      
 
Domain Number 2 Region: 154-244
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.2e-26
Family Pointed domain 0.0000831
Further Details:      
 
Domain Number 3 Region: 31-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000176
Family Ubiquitin-related 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004512   Gene: ENSGACG00000003430   Transcript: ENSGACT00000004526
Sequence length 440
Comment pep:known_by_projection group:BROADS1:groupXVI:7737638:7755172:-1 gene:ENSGACG00000003430 transcript:ENSGACT00000004526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSEQEEMIEIEIDEREKQACLEEGVEEQTITASDLIQQDIDINEPIGNLKKLLEPRIQ
ISLDAYDICLQDIQLHPDHSLFDQGVKTDGTVQLSLQIITKQGEEKLNILEIVKPVETVE
VVIDPDAAGEEGTMVEEGQLIAVERSGLSDETSEQVTRWAAALEGYRKEQVRLGIPYDPV
LWSADQVIHWAVWVMKEFNIDEMEIGSIHIPGRDLCSFSQDEFLQKVPNGEILWSHLELL
RKYVLASQDQSGGDATVTIDQPVHIIPAQVSTPTVVKVLKHSRGPRTPRISGGEERSSPG
NRTGNNGQIQLWQFLLELLTDKDARDCISWVGEEGEFKLNQPELVAQKWGQRKNKPTMNY
EKLSRALRYYYDGDMISKVQGKRFVYKFVCDLRTLIGYSAAELNNLVTDCEQKKLARMQM
HGIGQPITTVTLATTLEKES
Download sequence
Identical sequences G3NGQ9
69293.ENSGACP00000004512 ENSGACP00000004512 ENSGACP00000004512 ENSGACP00000004515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]