SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004577 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004577
Domain Number 1 Region: 300-609
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.58e-128
Family Mammalian PLC 0.0000000224
Further Details:      
 
Domain Number 2 Region: 147-299
Classification Level Classification E-value
Superfamily EF-hand 1.2e-43
Family EF-hand modules in multidomain proteins 0.00014
Further Details:      
 
Domain Number 3 Region: 630-756
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-31
Family PLC-like (P variant) 0.00028
Further Details:      
 
Domain Number 4 Region: 15-126
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-28
Family Pleckstrin-homology domain (PH domain) 0.0000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004577   Gene: ENSGACG00000003489   Transcript: ENSGACT00000004591
Sequence length 759
Comment pep:known_by_projection group:BROADS1:groupXXI:8038233:8047381:-1 gene:ENSGACG00000003489 transcript:ENSGACT00000004591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNGMSGKHGLEGDADLQFMLGGGDLVKVRSKSWQKNRFFKLQEDCKTLWYESHKTVRR
KQTFAIDDIASVRRGRQSEGLNKHTADGLEDQCFSIIFKDRTKNLDLLAPSGEEAKQWVN
GLDKLINNMLNLNRQQNIQIQSLNQNASWIFSCMRKADKNGDNMMTLKEVKHFLKQVNIE
VDDTYAEEIFKKCDASNSGTLEGSEIKHFYNLLTQREEIDVIYGDYAQTEGQMSAGDLLG
FLLREQREQVSMQDALKLIEKYEVDETAKQQKRMTKDGFLRFMNQEEGSIFNPAHKPVYQ
DMHQPLSHYYISSSHNTYLMADQLKGPSSTEAYIKALMKGCRCVELDCWDGANGEPVIYH
GYTLTSKVLFKDVIKVIKEFAFKTSEYPVILSLENHCTIDQQRLMAHHLISILGDALVTK
PLRNVTPTNFPSPEELKGKILIKGKCLKKVNPSLSNDGVVEEGTVSEEDEAADCENGQKA
KPKKSKIKLAKELSNIVVYCKSVHFNSFDHAKEMQAFYEMSSFKESKALTLAETSATAYI
HHNTEKLSRIYPAGSRTDSSNYNPVPLWNAGCQIVALNFQTPSKEMHLNQGRFLPNGASG
YILKPEFQRSLSSQFDPSTLSEGPWLQKKTLNVMVISAQQLPKLNKDKQSSIVDPLVRVE
IYGVPADNAIKATHHIDNNGFNPTWNESFRFQIHVPELAMLRFVVEDYDAASQNDLIGHY
CLPLSSAQNGYRHVPLLTKRGDVISSAGLFVHLMLTDAE
Download sequence
Identical sequences G3NGX0
69293.ENSGACP00000004577 ENSGACP00000004577 ENSGACP00000004577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]