SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004599 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004599
Domain Number 1 Region: 176-249
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.64e-24
Family PHD domain 0.0000624
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004599
Domain Number - Region: 14-92
Classification Level Classification E-value
Superfamily NAP-like 0.0523
Family NAP-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004599   Gene: ENSGACG00000003510   Transcript: ENSGACT00000004613
Sequence length 270
Comment pep:known_by_projection group:BROADS1:groupXVI:7806841:7809642:-1 gene:ENSGACG00000003510 transcript:ENSGACT00000004613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNPANGDPSHAVVNYVEEYLDLVESLPFDLQRSVSLMKEIDAKYQDVLKELDDAYERYR
RESDSLQRRKLQLSIQRALIRSQELGDEKIQIAGQMVELVENRTRQMDWHSELLLSSQEV
PKRDEVTPSSAAGDKAGGKRSRRQKNGENRESYGGLDQAEEVGAGASREKRAKTSSKKKK
RSKGKSEREVSPPDLPIDPDEPTYCLCEQVSYGEMIGCDNDECPIEWFHFSCVGLHHKPK
GKWYCPKCRGENEKTMDKALERAKKERAYN
Download sequence
Identical sequences G3NGZ2
69293.ENSGACP00000004599 ENSGACP00000004599 ENSGACP00000004599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]