SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004616 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004616
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 4e-24
Family Third domain of FERM 0.006
Further Details:      
 
Domain Number 2 Region: 84-182
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-22
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-20
Family First domain of FERM 0.0031
Further Details:      
 
Domain Number 4 Region: 383-433
Classification Level Classification E-value
Superfamily RING/U-box 0.00000327
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004616   Gene: ENSGACG00000003517   Transcript: ENSGACT00000004630
Sequence length 447
Comment pep:known_by_projection group:BROADS1:groupX:4879279:4891719:-1 gene:ENSGACG00000003517 transcript:ENSGACT00000004630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCHVTRPDSVVMEVEVDAKAHGEDCLNKVCRKLGIIEADYFGLQFTGSKGENLWLNLRN
RICQQMDNVTPCRLRLRVKFFVEPHLILQEQTRHVFFMHVKEDLHNGHLRMGSEQAEELS
ALLAQAEFGDYNQNTAKYWYSELYGEEPDTATVNSIVSRHKALEGLSQGSVEYQALQLVS
SLEHYGVEWHWARDANGQRLAVGVGPEGIAVCKEDFSLVNKISYPIIQIATQSGKSVYLT
VNKDMSDNVVLLFKLISNRAASGLYRAITETHAFYRCDTVTDAVMMQYSRDFKGHLASLF
LNENINLGKKYVFDIRRTSKEVYDHARRALYNAGVADLVSGGGGDDGRSSPSRSPSRDDP
QDDGLDCGGCQQNRALQERLQKLREALLCMLCCEEEIDAAFCPCGHMVCCQSCANQLQMC
PVCRSEVEHVQHVYLPTCTSLLNLTLT
Download sequence
Identical sequences G3NH09
ENSGACP00000004616 69293.ENSGACP00000004616 ENSGACP00000004616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]