SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004640 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004640
Domain Number 1 Region: 20-189
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-37
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 540-642
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 645-800
Classification Level Classification E-value
Superfamily PH domain-like 0.00000944
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004640   Gene: ENSGACG00000003544   Transcript: ENSGACT00000004654
Sequence length 1077
Comment pep:known_by_projection group:BROADS1:groupV:3791544:3799110:1 gene:ENSGACG00000003544 transcript:ENSGACT00000004654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLLECKSSGFCPTTTLPRVIKEKLAQSLKALQKRYVASDAVVTSEDGDANLLCCALEAV
FIHGIKSKYIRSEAGGRSRKGDRGSLPQPFFWGLLKAVTHRDVVKELEKISFVSTDVGRC
RSWLRLALNHGLLECYLTSLFREGSKLRAHYQPSALLLNAEEREVLLSYLQGLGSLTFSL
SYKSAVLNEWTTTPLALAGLCPSSQADAIDLPLDGGDPPTSKPELKESWDTASQSSSSSD
AADMQRGCPAMLTGTGALRGGSAALNSSNLSLDTTGSSQLSSSLSSDSLLQRQDPRSPAG
EQWSSCDLDVPINVTISTNRPRKEIIREMSYTYSETAVFSGSDSETQRPPTPSQEHLDPV
QNSVPSDSEPPAAPDKNLANGSPSEASTDTPPGSQPDTDLVQVSTASEPVDEGHISGVQA
SEPKCRNTSNAQRRANEILLSSPPQEHSRSWISEDDIYKPHPEEVSDHDEAPPPAPAPTE
LQVSQSPPSVVHRSLSQTGRVSGGVSWDLTRSCIPHQVAIALTLGRDSRLLQHDRLLGLS
NPFRGLLKLGHLERRGTMGIWRDHYCELSPFEFRLYLNAEERTCCDNCSLLRCEDARVAS
PEGRFELTFPGKRLCLRAANRGEAEDWVDRIVEAVNKCRPAPCADEQWEVLRPPCENGVD
ASGPPSVPSSPERGPSPPDSGPSPPPPPLEEEFDWTRTADVENDAIKEAVLYFSTDPEAR
TWAPLVFSLSLEALRGFQVREGRKLLWRTLPVDEIRDVVPDVSQGGAAFFKLLTLRETLR
LKAENPDEARSWRVLIRGALDSYLESGEDGGSATGNLYRLVQHRLKEDGALLVHLCTVPS
EKGLDSQGFKCAGCPQPIGPSRGRARLCEFSGQYYCDSCHHGDTTVIPSRMVHNWDLTRR
EVSKKALHLLAQVEQEPLLNLEQLNPELLTHAESMSQAHHLRKRLRLLADYLLTCRSGAC
KKLQDKMEQRTYALESSHLYSVMDLRQIADDEYVGYLITLLQHATNHVFHCDLCSQRGFI
CQICHADDIIFPFQLDITTRPRCEDCKAVFHLPCKADGVPCPRCERMKKYLEKNLLF
Download sequence
Identical sequences G3NH32
ENSGACP00000004640 ENSGACP00000004640 69293.ENSGACP00000004640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]