SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004670 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004670
Domain Number 1 Region: 158-259
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-33
Family Phosphotyrosine-binding domain (PTB) 0.00000584
Further Details:      
 
Domain Number 2 Region: 23-120
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-23
Family Phosphotyrosine-binding domain (PTB) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004670   Gene: ENSGACG00000003564   Transcript: ENSGACT00000004684
Sequence length 1061
Comment pep:known_by_projection group:BROADS1:groupXVI:7915270:7918611:1 gene:ENSGACG00000003564 transcript:ENSGACT00000004684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPNAGDPPLSPGNANASQKIKKCGYLKKQKHGHKRFFVLREPSDGLPARLEYYESEK
KWKNKSAAKRVIPLDCCLNINKRADAKHKYLIALYTKDEYFAVAAESEPEQESWHRVLTD
SMAEGKVYDGSAASNSASSLVGFDEASCGVIAPLSAAYKEMWQVNLKSKGLGQSRNLTGV
YRLCLSSRTISFVKLNSEVASVVLQLMNIRRCGHSDSFFFIEVGRSATTGPGEFWMQADD
SVVAQNIHETILEAMKAMKELSEFRPRSKSQSSGTNPISVPTRRHLNHHPPPSQTGLPRR
SRTDIAAMTSPVSKFSSCRIRTASEGDGTMARPMSVTGSPLSPGVRRTLLTRSHTISMRP
CRTFESSSLQHSKSMSMPQSPTPPIATNGLGNVSSCPDSGAPRPSSCTASFSGSPSDAGF
ISSEEYGSSPADARDPRLLLTLRSNTPESLKADTPPSRDGSELEGYMVMERQNGYRRLAE
LDKAHRKRTYSLTTPRQQRGPPQVSSASLDEYTLMRATYNSGSQASRRCHTSSPKGVHPE
DFRDVQISAGGPRGDSGYMPMMPGVAAQSPWSRHDPYMPMSPMCVSAPKQIINPRSHSSA
GLTPHTDSPGSVSLEDSGYMRMLCGTKMSVESTDGKLTNGEYLNMSPVDPLTPPDYILSS
PGGDPHPQQHHKQPYSYSSLPRSLKDKDQYVLMCLQGQRIEEESNYCPVTPGAARVDGGV
VHHSRLRRPTRLALESLRTLPCMSEHPLPSEPRSPGEYINIDYSSAAHDLLASTVSASSV
SSMCAEEGSLALSDYANIDVGSPGHLDSQLHRGSPTERRLNQTPEVLACPSLVNAQVEEQ
KSPERQAEDDYTEMTFSPLPLATAPLPAVRSTEDAPLPTSLAAGVKRLSLESSIVNGGPP
SQVDSFLLGGPSLSVTLVDPHRGAKVIRADPQGRRRHSSETFSSTTTVTPVCPSFAHDTK
RHSSASVENVSHAVCSSEGSDEDYGSNSPMCREMSAGYQNGLNYIALNLMEGNLGGCRLG
GCDGLLTFKTTACGCKGGLNGFNTIPYASMGFKETATAVKG
Download sequence
Identical sequences G3NH62
69293.ENSGACP00000004670 ENSGACP00000004670 ENSGACP00000004670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]