SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004762 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004762
Domain Number 1 Region: 5-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-128
Family Motor proteins 0.0000000000151
Further Details:      
 
Domain Number 2 Region: 492-597
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.46e-29
Family FHA domain 0.00000945
Further Details:      
 
Domain Number 3 Region: 1571-1668
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-23
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004762
Domain Number - Region: 340-370,421-471,622-688
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0796
Family G proteins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004762   Gene: ENSGACG00000003623   Transcript: ENSGACT00000004776
Sequence length 1689
Comment pep:known_by_projection group:BROADS1:groupVIII:1684280:1711668:1 gene:ENSGACG00000003623 transcript:ENSGACT00000004776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTIVNPKQAKDNKSFNFDYSYWSHTS
PEDINYASQVQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQDVKDQQGIIP
LLCEDLFTKFNDNGDNSMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLMGPYVED
LSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDNTSEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSGSNKNKKKKK
VESFIPYRDSVLTWLLRENLGGNSRTAMIAALSPADINYDETLSTLRYADRAKQIRCNAV
INEDPNNRLVRELKEEVSRLKDLLFSQGLGDIIDMTNAMTGMSPSPSLSALSSRAGSIAS
LHDRIMFSPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMRED
GGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGVTRVGRVDAASRQDIVLSGHFIKDE
HCTFTSSTDKAREIVVVLEPCEGAETYVNGKRVTEPTVLKSGNRIILGKSHVFRFNHPVQ
ARAERERTPCAETPAEPVDWAFAQRELLDKQGIDMKQEMEQRLQELEDQYRKEREETNNL
LEQQRLDYESKLEALQKQVDSYYPETLEEEEEPEEEVQWTERERELAVWSFRKWRCYQFT
SLRDLLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDREKRHF
PRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAADVPNNTAEDGENVMTGGDPF
YDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSERGEVKGFLRVAVQAISADEEAPDYG
SGVRQSGTAKISFEDQQYEKFQSETCSVGLPRSGASQEELRFVEGEGQNAEPGPSADEVN
NNTCAAGTDEAESPLKSQGGPLDTTLEHLRVGNVFTFRVTVLQASSIPAEYADIFCQFNF
IHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFVDYIKSQPIVFEVFGHYQKQPF
LPLCKDVISPLRPCRRQFPRVMPLSKPDTVPATKLTAMTRPQAGPCHSKHDLMVFFEICE
LEATGDYIPAVVDHRGGMPCHGTFLLHQQPQGLQRRVTVTIVHESGGDMEWKDIRELVVG
RLRNTPEADETIIDPNILSLNILSAGYVRPMRDDRQFLDSDMPRTFYRFEAAWDSSMHNS
LLLNRVTPYGEKIYMTLSAYLEMENCTQPAIITKDVCMVFYSRDTKLSASRSIRNLFGTG
SLRAADGNRVTGVYEVSLCNLADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSL
ILDHQWELEKLSLLQDVEKTKHYLLLREKLESTMLMGQESLQSCITEELSECPQPPEVDQ
EVPSRSEITTERQRELAAKCLRLLTHSFNREYSHVCVSASESKISEMSVTMLRDSASISA
LNTITPSSTCPSLVEGCYGDAELRPPMPRSRAASPAPAPQQDTEAKKSAGGASETKPRIR
RFFPDITEIRVSPIVSKKGYLHFLEPNTNGWVKRYVVVRRPYVYIYNAERDSVERAILNL
SSAQVEYSEDQQAMLKTPYTFAVCTEHRGILLQATNDKEMHDWLYAFNPLLAGTIRSKLS
RRRAGPMRM
Download sequence
Identical sequences G3NHF4
ENSGACP00000004762 ENSGACP00000004762 69293.ENSGACP00000004762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]