SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004795 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004795
Domain Number 1 Region: 175-239
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.52e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 768-819
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000135
Family PHD domain 0.0045
Further Details:      
 
Domain Number 3 Region: 22-110
Classification Level Classification E-value
Superfamily RING/U-box 0.00000051
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 844-957
Classification Level Classification E-value
Superfamily Bromodomain 0.00000667
Family Bromodomain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004795   Gene: ENSGACG00000003650   Transcript: ENSGACT00000004809
Sequence length 1010
Comment pep:known_by_projection group:BROADS1:groupXIX:4629536:4637057:1 gene:ENSGACG00000003650 transcript:ENSGACT00000004809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENEAESMQVREEKSGATGQKHLDTCPVCRLNFHSREPKLLPCLHSFCKKCLPAPWRNLAA
AEPLNSPRPHSVIHGSIIFVQVNVMRCPVCRQECMEVDVMENVFVKDSVEAPSSTVERAV
QLCMTCDDNTEAVGFCVDCVEYLCSTCVEAHHRVKFTKDHTIRQKAEIIFPEVHGASPQR
QMFCNIHKQEPLKLFCETCDLLTCRDCQLVKHKDHNYQFLEDAYKSHKQHMENMTHQLQE
KKKHIEEISNSINKGLLQVDQNRTSVHDELKKSICSLILEINKKGKMLANQLEAVTKDHE
SVLRKQQEDIGYLSRHLDHVIHFTKWATARSGGTALLYSKRLILFQIGNLLRAKCSSSFI
PQSTVRFHSRASYWASNVDLGSLVAESVPGNQPGGFQGIPHQLSHPGPPSGSAHSFALGA
PHDTLTQLQMQVDKLTPQGDWQPRPPPPPRSWYQSVRLQPTVPGPPRGGGSPSLQPARRL
TGPPPNRVSPTSSLASPEFTPQPSRPRQFMSFLVEMNFNLGQVYDSKSQNTTQLNVQRNS
EPTLSSIGSLAGRYLVGLPSRPLRGMGGGSIYQPKAMDVFSPSPPYAHGGSSPQSRQTAV
EPTYVRNDPRGPVYVLKPNYPHNPPPALHHRSVQGEQNSPGKPPETQQAGGAVGSAVKKR
RRSSPVPIIVIKDEPDEDSSYVRRPQSNSYYMIIITFFLPVWGFQVQSKQRSSLPDSTGD
QPPISARGEENKGPTPLRSTGAEPHSRPPPPSSPRDQRGGARPPAPLDDPTGGWCAACHT
GGQLLCCHKCARLFHLWCHVPTLLKYPSGEWLCSLCRDPLAPEMEYDCQDEAGTEKKEAG
FSPVDKRKCEKLLLRLFCSKLSSASPGPGAPWVCANNWPAIKGTTNLSAVKERLEANQTP
CYRSPAHFVSDIRLRLGNGSALSEVDTQVTAAGRRLKELFEEQLGIVFPEQTFPETKLER
IPAGPPDSQLLSLDNIIQRAKRQRTCSDSQDAPSRPSGAEGTNLLNRSDI
Download sequence
Identical sequences G3NHI6
ENSGACP00000004795 69293.ENSGACP00000004795 ENSGACP00000004795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]