SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004801 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000004801
Domain Number - Region: 521-568
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0982
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004801   Gene: ENSGACG00000003655   Transcript: ENSGACT00000004815
Sequence length 610
Comment pep:known_by_projection group:BROADS1:groupXX:1359967:1367588:1 gene:ENSGACG00000003655 transcript:ENSGACT00000004815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHAPYSSFTNGIDRLNRARPPARLVFSLSLPDQFTWTNYEDEAWRSYLENPLTAATKAMM
SINGDEDSAAALGLLYDYYKIPRERRCAVSGVKPTEPPPGGQENCGSLEMLDCHLQALRS
MPVNLSLNNPAAAGHQGSRQGAAFLAGEARGGEGKGGGVAALVKTEGLASNSGETYREEP
RAEVRRAYGHNHYDLSRVGFLKEEQRGTPDSTYEEAVGEGELSNECIGLPTRLCCHSGSF
QYCLEACMSLRPWQGEGPMAYLNRGQFYCLTLSKVGFASSQRQPRGKVRSVVMVVFGEDK
CRDEQLKNWKYWHSRQHTAKQRVLDIADYKESFNTIGNVEEIAFNAVSFTWDVGEEAQVF
ISANCLSTDFSSQKGVKGMPLIIQIDTYSYNSCSSRPIHRAFAQIKVFCDKGAERKLRDE
EKKQLRKRMKGLGKHGNTVQTSPCKRPENTLFKTMMDLDSQPVLFIPDVYFGNLQRAGQV
FAFNTEEDNRDGSVLVKRISAAAEEEVCPPQPKKSKVEVQRKVLLYVRKECDEVFDALML
RTPTLKSLMEAISEKYAIPVDKMVRVYQKSKKGVLVNMDDNIIQHYSNEDTFILAIEGSA
ESLRVTLSEI
Download sequence
Identical sequences G3NHJ2
ENSGACP00000004801 69293.ENSGACP00000004801 ENSGACP00000004801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]