SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004834 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004834
Domain Number 1 Region: 308-571
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-71
Family Protein kinases, catalytic subunit 0.00000000275
Further Details:      
 
Domain Number 2 Region: 24-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-22
Family Ras-binding domain, RBD 0.0001
Further Details:      
 
Domain Number 3 Region: 95-148
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000568
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004834   Gene: ENSGACG00000003668   Transcript: ENSGACT00000004848
Sequence length 609
Comment pep:known_by_projection group:BROADS1:groupXIII:1005470:1012948:-1 gene:ENSGACG00000003668 transcript:ENSGACT00000004848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACPVSSCRSSGETSPEDVPRGGGTIRVYLPNKQRTVVNVRQGQTVYESLDKALKVRGLSQ
DCCAVFRLLEGRKRLTDWETDITPLVGEELLVEVLDDIPLTMHNFVRKTFFKLAYCDFCH
KFLFNGFRCQTCGYKFHQHCSSKVPTVCVDMDTVTKRNDTNPCTDEYPRILLPENSPSQS
NLALTPEPAGTDLLSPTSAFHFPMPSGEGQSLQRHRSTSTPNVHMVSTVGPAGTSIIEEA
LKSNNILVLAGPEPSPKPSTSPPSSLGSPGRRPPKSPSEHKERKPSSSDDKKKVHRGGYR
DSSYYWEVHSREVTIQKRIGAGSFGTVFKGKWHGDVAIKILKVTEPTPEQLQAFKNEMQV
LRKTRHVNILLFMGYMTKPNFAIITQWCEGSSLYRHLHVTETKFDTMRRIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGWTVKIGDFGLATVKSRWSGSQQVEQPSGSILWMAPEV
IRMQDSNPYTFQSDVYGYGVVLFELMSGTLPYCNINNRDQIIFMVGRGYLSPDLSKLFCT
SPKSMKRLIVDCLKFKRDERPLFPQILVAIEQVQDLLPKIERSRSEPSLHRAVHAEDLNP
LLFHTTRLM
Download sequence
Identical sequences G3NHM5
69293.ENSGACP00000004834 ENSGACP00000004834 ENSGACP00000004834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]