SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004860 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004860
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.6e-17
Family PB1 domain 0.00012
Further Details:      
 
Domain Number 2 Region: 910-946
Classification Level Classification E-value
Superfamily UBA-like 0.000000183
Family UBA domain 0.003
Further Details:      
 
Domain Number 3 Region: 218-265
Classification Level Classification E-value
Superfamily RING/U-box 0.000000294
Family ZZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004860   Gene: ENSGACG00000003702   Transcript: ENSGACT00000004874
Sequence length 956
Comment pep:known_by_projection group:BROADS1:groupV:3971632:3981484:1 gene:ENSGACG00000003702 transcript:ENSGACT00000004874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPVTIKVNFRGNVRSFWSDLDKLEWESVEAWIKASFGINHFQVKYFDEDNEEICINSQ
DEYEEAIKSAEKQGNQLHMNVYKMKGQACGGPPKTEVKELKGDLRPAPPYPSRVKTVDKG
TQVTPEREAVRNHVTVKDNKGNKPEDEPPPMWFRSYMDKFKDEVVKEVVERMCSDFSGQC
CTHKSSDGPLEASAASSGPTGPRPGPSTSTGSLGYTPNCSSCNKLTSEGAYKCSVCPSCI
LCEMCRHSHDPSHNLVRTKTPLSIPEHGMSGELSLLSRLHKMEENTRFPRRGDRTVRKAE
RQRLKAERRQLRAEVKEIKKKLRLLQKIWGPAFGCYKKPGLFSTMLCTLETRGPGVSNTS
LVSTMAALFLDENLPDGTRLEPGTKFIKYWKMRNSGTISWTAETKLVFMWGNLGLASGDR
REVPVPLLLPGQVGVVSVAFAAPVTEGTYTSHWRLAHCGCQFGPRVWCSIVVDAGDGREA
LGHQSERPASLDTRRHPVQPQREPRPTASQPKQKLEVVVVKEQEGSSQDSGPGLPVDLNH
VDYYFPSVDLLTAQDLLSFELLDINIVQELEKVPNNTPEDLTPCISPLPHDAPVLEKDIT
ARIREEAEVTGVRNLFGVKVRQQSVPEGQEEDREEEISGAQFLCETVIRSLALEEAPDHR
PPRRAQHSPHKPQGEEPLNLYDIEEEEVLVPEDMHDMEHKEDGGTKGEVSSQTSSVSSCD
DYIIVLPDCFDTSRPLGESMYSSAMSQPDADAAESLPGGTAAREAAGGGRRRGFSPPSHS
SVNQMLCASQTLDAVTLTPEVVPPPPPPLPDLPRPPPALYSPRLRMFVLFPLFSAVSSGL
SRSAGSASSAFETYNPRPSNALQPRGQGGITEGLVKGALSVAASAYKALFTGPNCSIQTP
PAYKEKQDPSLMAMLLEMGFRDQRLNQQLLRKHGYSLLHTVNELVQMTEDGHNKAL
Download sequence
Identical sequences G3NHQ0
ENSGACP00000004860 69293.ENSGACP00000004860 ENSGACP00000004860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]