SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004957 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004957
Domain Number 1 Region: 56-225
Classification Level Classification E-value
Superfamily vWA-like 3.25e-16
Family Integrin A (or I) domain 0.039
Further Details:      
 
Domain Number 2 Region: 323-385
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000022
Family TFIIH p44 subunit cysteine-rich domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000004957
Domain Number - Region: 286-312
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0408
Family PhnA zinc-binding domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004957   Gene: ENSGACG00000003759   Transcript: ENSGACT00000004971
Sequence length 392
Comment pep:known_by_projection group:BROADS1:groupXIII:1043519:1051787:-1 gene:ENSGACG00000003759 transcript:ENSGACT00000004971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEPERTKRWEGGYERTWEVLKEDESGSLKATVEEILFQSKRKRVTESHGQVRLGMMRH
LHVVIDCSRTMDDHDLKPNRLTASLKLLETFVEDYFDQNPISQLGLITTKNKRAEKLTDL
AGNPKKHIVALKKAVDTVCIGEPSLYNSLHLAIQTLKHMPGHTSREILVILSSLTTCDPA
NICELIKTLKSLKVRVSVIGLSAEVRVCTVLTRETGGSYHVILDESHFKELLMLHVKPPP
ASSSSECSLIRMGFPQHTVAYLSDQDAKPSFSMAHLDSSGGAGLSLGGYFCPQCHAKYTE
LPVECKVCGLTLVSAPHLARSFHHLFPLQAFTESPAEGLHVDRFCQACQGELKDKSIFTC
PICGGVFCSECDLFIHDSLHCCPCCIHNPSNP
Download sequence
Identical sequences G3NHZ7
ENSGACP00000004957 69293.ENSGACP00000004957 ENSGACP00000004957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]