SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004981 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004981
Domain Number 1 Region: 42-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.23e-251
Family Motor proteins 0.000000000273
Further Details:      
 
Domain Number 2 Region: 1929-2045
Classification Level Classification E-value
Superfamily Second domain of FERM 6.54e-20
Family Second domain of FERM 0.0051
Further Details:      
 
Domain Number 3 Region: 2046-2136
Classification Level Classification E-value
Superfamily PH domain-like 7.01e-20
Family Third domain of FERM 0.024
Further Details:      
 
Domain Number 4 Region: 1233-1334
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-16
Family Ras-binding domain, RBD 0.058
Further Details:      
 
Domain Number 5 Region: 1829-1937
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000134
Family First domain of FERM 0.051
Further Details:      
 
Domain Number 6 Region: 791-856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000266
Family Motor proteins 0.024
Further Details:      
 
Domain Number 7 Region: 1326-1420
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000602
Family Second domain of FERM 0.014
Further Details:      
 
Domain Number 8 Region: 1557-1613
Classification Level Classification E-value
Superfamily SH3-domain 0.00000302
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004981   Gene: ENSGACG00000003775   Transcript: ENSGACT00000004996
Sequence length 2151
Comment pep:known_by_projection group:BROADS1:groupVIII:1911173:1929081:1 gene:ENSGACG00000003775 transcript:ENSGACT00000004996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLSKGDFVWVDIGAHVPIGAEVKVTDTGQFQLIDDEGKEHKINKKTEGAIRPMHPTSV
KGVDDMIRLGDLNEAGLLRNLLVRHKEGIIYTYTGSILVAVNPYQLLPIYTVEQVHMYTD
RRLGELPPHVFAIADSCFFNMRRNQRNQCCVIRSGESGAGKTENTKLMLQFLAAVSGQHS
WIEQQILEANPILEAFGNAKTVRNDNSSRFGKYIDINFTKGGAIEGARIEQYLLEKSRVC
RQAPEERNYHIFYYMLMGMPAEQKKILSLGNAAEYKYLTMGKCTSCDGRDDVKEFAHFRS
ALKILMFTENDSWEICKLLAAILHLGNVDFEATIVNNLEACKILTSPNFNMASQLLEVEP
KALEKSLTQHSLMTGRESVTKPLTSAQAKDGKDAFVKAIYGRLFIWVVKKINAAVYKPPE
DGEEVRQSIGLLDIFGFENFNKNRLAFTATLQPSVPLLLQHVFKLEQDEYARENIVWKQI
DYKDNQGTLDMLANKPLNMLALIDEESNFPKGTDSTLLHKLNQVHGKGDIYLCPKNNYET
QFGVKHFAGEVHYDSNGFLEKNRDAHSSDLINLMETSTNKLLKEAFHNALSQGADGKKRV
PTLIGQFRQSLDSLMKTLTVCQPYFIRCIKPNDFKRPMLFDRELCMRQLRYSGMMETIRI
RKSGYPVRYTFSEFLNRYRVLLKTTLCDPKTQQKSKEECCDSICESILAEEGDWKRGKTK
IFLKDFHDTMLEVERMKELNEKALVIQKVMRAYKYRRQFLKKRAGALVIQKCWRGHKGRK
LYKVVQLGFARLQAQVRSRQLQFRYEKQRKASVVLQARVRGYQARKEWKRKRDAVILLQA
HARGGLARKAMKKRKTDHSIINILKLKKGAKSSLVLCAFVQMYLSAKEKEEEQRAVLERQ
KHLEEILRRRKEMEAKAQTESITDQEMVDSIFDFLPGMVGGGQEGQAPVGYEKFEGRVTE
EIDIDEQPMEEGLPQEDDDDLDEYSFSKFASMYFQGAATHSHIRLRLRQPLLYHEDEGDV
LASLTVWWIILRFMGDLPDPKKRVQAQGGSPQERLMPQELMSRNDRRLSHMVGLDQRVLR
NKKERKPSTVPEEPTQNRKASIFTDLLTVSEDDDIMVGEGPTLDRPLTVLEKLHIIVGYA
IVRPELRDEIYCQICKQLQDNNTRNSYFRGWILMSLCLGIFPPSDRFIRYLQSFIRFAPG
GYAAHCAERLRRTAMNGVRGEPPAWLELQAIKTKKPMIVSVSLMDGRSINLPVDSASTSK
EICQLLSNKVKLKDTFGFSVYVALYEKVWALGGGREHVMDAISQCEQEVKRRGGQEQHAP
WRLFFRKEVFTPWHDCKEDTISTDLIYRQFIHGLKCGEYQSKKEDDLVQLAAKHLYIQNG
ADSSAEHVKEAVQDCVNNTLLEAKSEGKWLQMVSAAHSQGPYLSSRQKAESVKAEMVDYA
RETWPMFFSRFFEVVKLSGPALPKSKFIVAINWTGITFLDEREKRLLELSFPEVTGVHTM
REAKGSGQAVNLLTLKGDFSLSGGTAEDMAELVTMFLSGLRERSKYAVTLKEADRQDDPT
FLSFKKGELIIIIKDDEFSEQRGWIKGQSESTRQTGAVPTEAILILPTLSKPTNAVMSLL
NLSPNQRENIIRENQKETGTMERLAPATLREFSLEYFRQPSKDVNRQVMSRNAAPERLWA
NSREPIRQPLLKKLVGNPELSHKACLAFTAILKYMGDYPTKQTQSPLELTDQIFGPATKN
EALRDEIYCQIMKQMSGNNNRLSVEQGWQLLWLCCGLFAPSQSLLRHARRFLETRSREPL
AADCLQRLQSSLSRMEPRKLPPHQTEVDAIQQNSTQIFHKIHFPNDTEEIFEVATNTRIK
DLIQNITKKLSLASADGFSIFVKTQDTVLSLNDTDYFFDSLRQITDWSKKAKRIKDGGPV
NIAYLVFFMRKLWFNVIPGRDAEADLIFHFPQELPKYLRGYHVCTKEEMVNIAALLFKIK
VGNDKSQLVMIPKMLKELVPADQLKAMSENEWKKTIVASYNKQAGTTVEDAKVAFLKAVC
RWPTFGCAFFEVKQTSEPSFPDIVRIAVSKEGLTIIHPKSKEVLANHPFNRIANWCSGST
YFHMTIGNLVKGSKFLCETSLGYKMDDLITSYVTMYLNEQKVLQTRNQRFN
Download sequence
Identical sequences G3NI21
ENSGACP00000004981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]