SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005031 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005031
Domain Number 1 Region: 506-875
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.03e-116
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 57-167
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-17
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005031   Gene: ENSGACG00000003833   Transcript: ENSGACT00000005046
Sequence length 878
Comment pep:known_by_projection group:BROADS1:groupV:4513231:4520750:-1 gene:ENSGACG00000003833 transcript:ENSGACT00000005046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYGSSLNLSQSLASGPEKSSPAWKPSHSRSSSTLSSSRHVVKDWEVIDETQAGGDNPH
EVTTPGICEGYLLKRRKWPLKGWHKRYFVLEVGNLRYSKNQQDVCRGRVQGSLDVGLAVM
SINKKSNRIELDAGDILYHMKAKSHELFYIWVTKLQAHRLYKKNASSHCAAAGQSLRNGD
LVITERAVHVERNATVFEVSGGVAHPAEAPSGVPPSANSKVSAWLQQSHDPDLCVQELHR
CNVELSEINRLIQRLQMLDTGQTLTNGDLKRIISIQNLSLEKPRKPRSGKIWGHSRTLSR
VEALGMLSSSHLGSSTNLGASASSIPDYVFSQLPPPTFTSPEGKRIQQDICAMSLRVIAS
LKAVHETLSQERQKLQEAWETNNIHQANTLAEVLTHIPLLVFDGRGFLCVFFLLLLHQQP
AAESHGPPSVADSAAEYFDASYDVICGSSSDVSDESGLSEGSTTDSEPEEGHASATRKYR
ASISRTPNSAVPKSTGRRTTLPAHCPDNSHVGLMAILYNNIGKDLARVSMPAPLNEPLNL
LQRLCEELEYSELLDTANNTPDPYQRMVYIAAFAISGYSTATFRNRYKPFNPVLGETYEC
IREDRGFRLISEQVCHHPPISACHADSENFSFWQDQRWKNKFWGKSLEILPTGMVNATLP
RYGDHYEWNKVVTCIHNVLSQQRYLEHYGEVTIRNLKSDVCTCKITFVKSRYWGSETNKN
EVQGAVLDQSGSIIHRFGGLWHEGIFCDTLPTPKCVWKPNPQPKDHLLYYGFSSLAMELN
ELDADLKPLLPPTDSRLRPDQRLLEEGKVEEADRKKDDIEEFQRERRKELNKKGKEHVPR
FFRKAKDSCGRDVWLSNDSYWKLRENPGFANTENINVW
Download sequence
Identical sequences G3NI71
69293.ENSGACP00000005031 ENSGACP00000005031 ENSGACP00000005031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]