SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005038 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005038
Domain Number 1 Region: 6-308
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.31e-65
Family BAR domain 0.00000000507
Further Details:      
 
Domain Number 2 Region: 484-636
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-27
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Domain Number 3 Region: 284-379
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-22
Family Pleckstrin-homology domain (PH domain) 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005038   Gene: ENSGACG00000003834   Transcript: ENSGACT00000005053
Sequence length 656
Comment pep:known_by_projection group:BROADS1:groupXVII:1272439:1279491:-1 gene:ENSGACG00000003834 transcript:ENSGACT00000005053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIEKLPIEETLEDSPQTRSLLGVFEEDTTAMSNYCTQLYEAMQRIYDAQNELSAATHL
TSRLLKEYDKQRFPLGGDDEVMSSTLQQFAKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQISSDDHDVAINRYSRLSKKRDNDKLRVEAVEDVYTSRKKHHQTMMH
YFCSLNTLQYKKKTALLEPLLQRSKPASSSLQISFFKLGSENLTQQWEDFLGTIGTSVQN
LSSRKLEEVGQMQETIQEMERSCDQLYAPCDPDPAHSPVCRNLTRKQGYLHIRSKTGLVS
SSWERQYFFTQGGNLMQQGRGEVAGGLVTDLDNSSVMAVDSDDRRFCFQVTSFDGKKVVT
LQSESRKDCEEWIATINNISKRIYLSENAEELAARVNQSALEAVTPSPSFQQRHESMRPS
SSSKGRAGRASSISSVGSEPSPALSVLSLDALVAPDTPIQFDIISLFSEENAGQNKTAQS
GRRSNPFGETGDSTPEDSEDSILHQLFIVRFLGSMEVRTAETADVIPETMRQILAARAIH
NIFRMTESHLLVTCDCLKLIDPQTQVTRLRFPLTSVVQCSSHQDNRRLFGFVLQPAGGQG
DGRAVCYIFESNNDGEKICDSVGLAKQIAFHSEMDRKVSHILSRTQKTQNQQRKRE
Download sequence
Identical sequences G3NI78
ENSGACP00000005038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]