SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005045 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005045
Domain Number 1 Region: 6-303
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.63e-73
Family BAR domain 0.00000000239
Further Details:      
 
Domain Number 2 Region: 477-629
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-27
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Domain Number 3 Region: 279-374
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-22
Family Pleckstrin-homology domain (PH domain) 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005045   Gene: ENSGACG00000003834   Transcript: ENSGACT00000005060
Sequence length 707
Comment pep:known_by_projection group:BROADS1:groupXVII:1272840:1279394:-1 gene:ENSGACG00000003834 transcript:ENSGACT00000005060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIEKLPIEETLEDSPQTRSLLGVFEEDTTAMSNYCTQLYEAMQRIYDAQNELSAATHL
TSRLLKEYDKQRFPLGGDDEVMSSTLQQFAKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQISSDDHDVAINRYSRLSKKRDNDKLRVEAVEDVYTSRKKHHQTMMH
YFCSLNTLQYKKKTALLEPLLGYMQAQISFFKLGSENLTQQWEDFLGTIGTSVQNVRREM
EEEVGQMQETIQEMERSCDQLYAPCDPDPAHSPVCRNLTRKQGYLHIRSKTGLVSSSWER
QYFFTQGGNLMQQGRGEVAGGLVTDLDNSSVMAVDSDDRRFCFQVTSFDGKKVVTLQSES
RKDCEEWIATINNISKRIYLSENAEELAARVNQSALEAVTPSPSFQQRHESMRPSSKGRA
GRASSISSVGSEPSPALSVLSLDALVAPDTPIQFDIISLFSEENAGQNKTAQSGRRSNPF
GETGDSTPEDSEDSILHQLFIVRFLGSMEVRTAETADVIPETMRQILAARAIHNIFRMTE
SHLLVTCDCLKLIDPQTQVTRLRFPLTSVVQCSSHQDNRRLFGFVLQPAGGQGDGRAVCY
IFESNNDGEKICDSVGLAKQIAFHSEMDRKAVEKRKEHDKAKERQQEELSKQKQIEKDLE
EQSRLIAASSRPGNQPAADGQVLVLSNSHSEDSDAGEEGKKRGESEA
Download sequence
Identical sequences G3NI85
ENSGACP00000005038 ENSGACP00000005045 69293.ENSGACP00000005045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]