SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005082 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005082
Domain Number 1 Region: 111-320
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-54
Family DBL homology domain (DH-domain) 0.0000785
Further Details:      
 
Domain Number 2 Region: 323-458
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000126
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005082   Gene: ENSGACG00000003871   Transcript: ENSGACT00000005097
Sequence length 466
Comment pep:known_by_projection group:BROADS1:groupXVII:1308549:1313794:1 gene:ENSGACG00000003871 transcript:ENSGACT00000005097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGQRPFFLLVHQFKSGCSVEVIKGNSGHMGKRVEEPGTKRSKLVSRVTSLANLLPPVK
AAPLKRIGQTLQRSISFRNESQMERTAARVATATAPASKRRDSKLWSETFDVRLGATQPL
SPKEIKRQEAIFELAQGEQDLVEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPL
HEDLLSHLRDARKPDGSTEHVGRILTDWWGLQLPCLSCYTSYCSNQVKAKALLDQKKQDR
RVQDFLQRCLQSPFSRKLDLWNFLDIPRSRLVKYPLLLREILKHTASEHPDRQHLDQAML
MVQSVVADINRRTGESECQYYKDRLLYSEDGQRDELIARSRTLSCHGELKNNRGLKLHVF
LFQDVLVITRSASLNDQPVGYQLCRRPIPIRQLDLEDLSDGEMRVGGSIRGAFSNNERTK
NFFRVSDRTGGALQSHCFQASDAFNKQQWINCIRQAKEAAALTADQ
Download sequence
Identical sequences G3NIC2
ENSGACP00000005082 ENSGACP00000005082 69293.ENSGACP00000005082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]