SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005144 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005144
Domain Number 1 Region: 1-439
Classification Level Classification E-value
Superfamily Sema domain 9.94e-106
Family Sema domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1292-1421,1597-1753
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.1e-45
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 779-875
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000369
Family Other IPT/TIG domains 0.0032
Further Details:      
 
Domain Number 4 Region: 442-491
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000589
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 874-964
Classification Level Classification E-value
Superfamily E set domains 0.00000000616
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 6 Region: 965-1073
Classification Level Classification E-value
Superfamily E set domains 0.0000756
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005144
Domain Number - Region: 1444-1539
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00501
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005144   Gene: ENSGACG00000003911   Transcript: ENSGACT00000005159
Sequence length 1816
Comment pep:known_by_projection group:BROADS1:groupXIX:5234537:5263312:1 gene:ENSGACG00000003911 transcript:ENSGACT00000005159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTSETAINNVVQDPQTGRIYLGAVNAIYQLGPSLRREARAETGPKEDARTCTPPASACHD
TKPMPNLNKLLLVHPSNGSLIVCGSRYRGICSLLNLSNVEEQLYYSDNKGERTYVASIED
NVNVVGVMSNYSRDGHSFGVFLVGKGYGSLDSTKLISTRILQDVWDWVVFESIIEASTVQ
TTPFVPKYLHDFRHAFKEDGFVYFLFSRTLDGTDNKNLTFVSRLCEDDHHYYSHTELQLV
CGKNTRYNKVQAAYVASPGKELARVMTESVASQEDDVHQSALCMYPLDSINERLVDIIGA
CYSNSGKHHGLPVVDIPYSSKTDCTSTIPDTLENFKCGGDFLPSPLASNPRYALTADAVW
SWSGMLTAVAVTVENDHTIAFLGNTQGEVFKVHLADTAYLYSKTPGDAMGEKVNKNLFFD
LSQSHLYITTEKKITKVPVQTCLQKKDCQSCVELRDPYCGWCVLEGRCTRRSECRRAEEK
NGWLWSPKQQCVKIVSFYPANLSFKKTQKVNINIPSLPAIGLSDRLLCSIKSFESEGTMS
DSGQVSCDLPNPSLIPPTPADQDFVAVAIRVFVNETVELATRDFKFYNCAATVKKSENTP
CMSCVASSWGCQWNTQDYTCSDMDEGAVGPNIIKHRQGAKCPHFENPDPVLIPVGYKTRI
SFEGINLDVYQGHVFIIGTELMRNTEEEVKFENGHFYTFSGFNFSYDKSPDTNVLFYVKH
KESGKKMDSTLNVTLYNCSVGREDCSLCKNADPKYRCVWCAKQRACVYEKLCNPDHAQCP
DPQITDIIPRFGPLRGGISITIRGSNLGIYKEDIKSISVVGQPCIHQKEKYSVSTSVVCE
IGPVGPENNRNGTVEVEVKGGKRGTSSVYFTYRDPIPKTVRPFRGPKVGGTLITISGQFL
ETGSMDDVTVTMEGLACTVLSFGQEITCRTGEYRSDKVPSDPLTVTVKYGKETITSIPRA
FLFLDNPVVLDHLPKASFVCGGRNIVVTGSGFDLIQTAFLKVQADNSIAFEKLRGQAVTQ
SIVSPASKEAHEKNDTVIQFRSPRVNRSLNQPFKTFIQLDNLEKQLSPFEYHPDPSFHEL
TKKVITETSIIIVTGRGFSKAMTAKEAQAFVGDVPCLVNTLQDDKLFLDPPSTMPSARSR
RHRRDTRPELLDLTIKFGNGEWVVGSVQYEKKNELPLYIIIPAVIVPMLLIIAISVYCYR
RKSQQAEREYEKVKHQLENLEESVRDRCKKEFTDLMIEMEDHTNELSEGRIPFLDYKTYT
DRVFFLPSKDGANDVMITGKLNIPEARRAVVTQALNQFSNLLNSKTFLLNFIRTLERSND
FNARAKVYFASLLTVALHGKLEYYTDIMRTLLLELMGEYVLSKNPKLMLRRSETVVERML
CNWMSICLYQFLKDSAGEPLYKLFRAIKHQIEKGPVDARVKKAKYTLNDTGLLGDDVEYS
VLTLQVLVHGEGPDVTPVKVLSCDTISQVKEKIIEQVYRNLPYSQRPKVDGVTLEWRPGS
TGQILSDLDLTSQKEGRWKRINTLAHYNVRDNATLVLSKAFSVHQNYDQNQENHEERNAL
LEDDKVFHLVRPADELDEVKSKRGSMKDKSMTKAITEIYLTRLLSVKGTLQQFVDDFFRS
VLCSGAVVPPAIKYFFDFLDEQALKHNNVDEETIHIWKTNSLPLRFWVNILKNPHFTFDV
HVSEVVDASLSVIAQTFMDACTKSEHKLSRDSPSNKLLYAKEISTYKKMVDDYYKGIRQM
VPVSDQDMNTHLAEVSRSHTDKLNTQVALHQLYQYASKYYDAIITSLEEDPAAQSKQLSL
RLQQIAAALENKVTDL
Download sequence
Identical sequences G3NII4
ENSGACP00000005144 69293.ENSGACP00000005144 ENSGACP00000005144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]