SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005148 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005148
Domain Number 1 Region: 302-602
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.92e-88
Family p120GAP domain-like 0.0000547
Further Details:      
 
Domain Number 2 Region: 166-304
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000256
Family Synaptotagmin-like (S variant) 0.055
Further Details:      
 
Domain Number 3 Region: 115-168
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000112
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005148
Domain Number - Region: 1083-1156
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0146
Family Myosin rod fragments 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005148   Gene: ENSGACG00000003919   Transcript: ENSGACT00000005163
Sequence length 1190
Comment pep:known_by_projection group:BROADS1:groupX:5337399:5352880:1 gene:ENSGACG00000003919 transcript:ENSGACT00000005163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSRRASFASVRQSSMETPPNATPQPFRQPKLQSFLNRRLKGSIKRAKSQPKLDRTSSFRQ
MILPRFRSADQERTRLMQSFKESHSHESLLSPSSAAEALDLVLDEDAIIKPVHSSILGQE
YCFEVTTNSGTKCFACRSASERDKWIENLQRAVKPNKDNSRRVDNVLKLWIIEARDLPAK
KRYYCELCLDDMLYARTTSKPRTDTVFWGEHFEFNNLPTIRSLRLHLYKETDKKRRKEKS
TYLGLVSIPISSITGRQFVEQWYPVIQSSVLAKSGGVGSTKVINASLRIKSRYQTMNILP
MELYKEFAEYITNNYRTLCAVLEPLLSVKSKEEVAFALVHILQSTGKTKEFLSDMAMCEV
DRFMDREHLIFRENTLATKAVEEYLKLIGHRYLKDAIGDFIRALYESEENCEVDPMRVPP
SVLADHQANLRMCCELLLCKIINSLCIFPRELKEVFASWRARCAERGREDLADSLISSSL
FLRFMCPAIMSPSLFNLMQEYPAERTSRTLTLIAKVMQNLASFSKFGPKEEYMYFMNEFL
EMEWGSMQQFLYEISNMEAGGNAGGFEGYIDLGRELSMLHSLLWEVMGQLSKDAILKLGP
LPRLLNDISVALRNPQLHMPTNHQPDRPKDRLFSRPSFNRLMSSDFQSLMMRDLNRYSPV
VSFLVRKLLNSIDISRLPSPTTGVSAERDLRSSREVFYVTRPPLARSSPAYCTSSSDITE
PDPKVHSVNKSVSMMDLQDSRMNSISNLNSVGDMLTSSQASIAGLGHSFGNLCGPLRVGG
HMPAGSSGSGLRLSQMGHIGGPTESISQQQQQAAAAMHFPLSFQNPLFHLAAQNSPAQPH
PHPPPLLLAPEPENGHHDYAPTFGNSAFSRSEDLSALRSQSSLVQPSIVHSHSYSDDFTR
QNQSNDFAWHQLSLQVQQQHLMGIVSQSGTGTGTPASLATPPTTVHHVRQSSMAQPQHLK
SQRSINIPATGTPPKVRPQSRNLLLDSDTNFSGSQPKSRQHNCSRHSSICSNQAINRSVY
GLLMHFLDKEGSQSTLNTPALNERTVAWVSNMPHLSADIESLRPDREGQLKEYSKSMDES
RLERVKEYEDEIHLLKERLKMSHRKLEEYEHRMVSQEQQTSKILMQYQNRLEDSERRLKQ
QQVEKDSQIKGIINRLMAVEDELRVGAIPDIKPRILTDQEGPRWLSLKNA
Download sequence
Identical sequences G3NII8
69293.ENSGACP00000005148 ENSGACP00000005148 ENSGACP00000005148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]