SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005181 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005181
Domain Number 1 Region: 7-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.24e-54
Family BAR domain 0.000000334
Further Details:      
 
Domain Number 2 Region: 280-375
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-20
Family Pleckstrin-homology domain (PH domain) 0.0000138
Further Details:      
 
Domain Number 3 Region: 480-622
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-18
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005181   Gene: ENSGACG00000003947   Transcript: ENSGACT00000005196
Sequence length 669
Comment pep:known_by_projection group:BROADS1:groupXIX:5289965:5303363:-1 gene:ENSGACG00000003947 transcript:ENSGACT00000005196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVHHKLLLEDALQDSPQTRSLLSVFEEDAGMLTDYTNQLLQSMQRVFGAQSEMGLATE
QLSRQLLDYEKKNFALGKGDEEVICTLQNFAKTVGELNSLHSELANQMADSMVFPLIQFR
EKDLSTLSEISTLKEIFGIATDEHEAAMVKYSRLPKKKENEKLKSDLVKEVAYTRRKQHQ
ASLQYYCALNALQYRKRVAMLEPMLGYTQAQISFFKKGIELMSKKMDNCLSSVSDMTQSI
QAQLDTEAEAMRGSQREFLSVEDTVYMPDKDIEPVNRTLIQKAGYLNIRNKTGLVTTAWD
RLYFFTQGGNLMCQPRGAVAGGMVLDLDNSSVMAVECEDRRYCFQITSPSGKTSMILQAE
GKREYEEWICTVNNISRQIYLTDNPEAVAIRLNQTAIQAVTPITSFEKRPEGSPNPDSSR
TEGEIELQAKITEKTGAAPEPEDLIAPGTPIQFDIMLPASEFHCVFLLPGRRTNPFGETD
DDCLTETGDSLLQQVFAVRFQGSMAVRCGNNQEVIYEAMRQVLAARAIHNIFRTTESHLM
VTSSSLRLIDPQTQVTRISFQLGDVCQFAAHQENGRLMGFVVEGRDWSDGDEEGEPSFSA
FVFESNTEGEKICYTINLAKDITEAKKDPEALAQLMKNMPLTSDGKFLLLEPETGDTSNG
AEEDLESEA
Download sequence
Identical sequences G3NIM1
ENSGACP00000005181 ENSGACP00000005181 69293.ENSGACP00000005181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]