SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005266 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005266
Domain Number 1 Region: 1252-1393
Classification Level Classification E-value
Superfamily PH domain-like 3.42e-49
Family Phosphotyrosine-binding domain (PTB) 0.0000011
Further Details:      
 
Domain Number 2 Region: 277-404
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.58e-37
Family PLC-like (P variant) 0.0023
Further Details:      
 
Domain Number 3 Region: 109-274
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-30
Family Dual specificity phosphatase-like 0.00021
Further Details:      
 
Domain Number 4 Region: 1115-1241
Classification Level Classification E-value
Superfamily SH2 domain 8.62e-21
Family SH2 domain 0.0026
Further Details:      
 
Domain Number 5 Region: 4-54
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000598
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005266   Gene: ENSGACG00000004001   Transcript: ENSGACT00000005281
Sequence length 1396
Comment pep:known_by_projection group:BROADS1:groupXII:3084372:3108060:1 gene:ENSGACG00000004001 transcript:ENSGACT00000005281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGEPHVFKEKTFKKKRQCSVCRQNVDNTGSFCRVCKTATHRKCEAKVTSACIPPPSNDLC
MQQRRGTAPSRQIQHLGSTKSLTYTKQRNTLPRSFSVDRVMERVMERHYDFDLTYITERI
ISVFFPPKLEEQRYRLNLKEVAAMLKSKHQDKFLLLNLSERRHDINRLNAKVHDFGWPDL
HAPPLDKICAICKAMETWLTSDPQHVVVLHCKGHKGKTGVIIAAYMHYSKISAGADQALS
TLAMRKFCEDKVSSSLQPSQNRYIYYFGGLLSGAIKMNSSPLFLHQVLVPSLPNFQGEGG
YYPFLKIYQSMQLVYTSGIYDLQGTGGRRLCVTIEPALLLKGDIMVKCYHRRAQSADRDT
VFRLQFHTCTIHGSQLWFGKGELDEACTDERFPSDATVEFVFSSGPEKIKGREYQKNDPS
VTVDYNTADPVVRWDSYENFNQRYQDSLEVDIAHTRGPVDGSLYAQIKKRRGPGSGSLTS
TNGSGPAAGLEEDRPDCVFSRGSDSALSAHSVHLNHSSVHPERQEDSISPLPPTRQERED
LARLLGGIEGNRDGERETAILDDGDSLPSDRSGTLRLSRSCSCRNGYRSQRCAEPGCDRT
LLMPNGYCLDRAPGTNGHHGATPSPPDLVWDRQHYLHRSCSEAHHHLHPHHSKPSTSPTY
HDIVLMDGLPAPGCPCRDCSIRKDDSAAYHSLRLDQGSELHWEREPGLRRGREMSLHWER
DREAELQWERDREAEYWRRRATVASYGPQGHDLPAFTFDPLPSGHPAYPEASRSHAHSHM
EQKYSSSSSGYQTPRQVCPCSPYQPSPSESRGYASGYQSESTSPLPPASSMTGPCSHGLR
SSGESVGWREHITHGSFKRVHRDGHAACSTPSDMSGPSTPVHTSSPLRTQPQSRREDPSA
PTAQAPPSFDPATASASSQGLGRALSSPIHTLSSLDTPSQPAPLAPQAPHPSEAAALPST
VAQAVPRPQGHTQTQGAGTTRPAQVTGPPSEAEKLTITPTNATSAPASPTPASSSTAQAA
CSSTESSPVSDTPVPGFATLGRRLMPLPEKRHPPVQPGFPSDGAATLRPAGGHAPPSSSQ
HQLHVTFSPTVGEIAAPAGQNDGSPPVESENANRVSVKFVQDSSRFWYKPGISREQAIAA
LKEREPGTFLIRDSNSFQGAYGLALKVATPPSNVNHSMSDPLEQLVRHFLLETGPRGVKI
KGCQNEPYFGSLSALVYQHAITPISLPCALKITEKDLIGEVPEVQPVNNISTAADLLKQG
AACNVLYLNSVETESLTGPQAIAKGTDASLGRSPRPAGTVVQFKVTSQGITLTDSQRRVF
FRRHYPVSSVTFSSIDPKDRRWTNSDSTANKVFGFVAKKPGSSSENVCHLFAELDPEQPA
SAIVNFINKVMLSQRR
Download sequence
Identical sequences G3NIV6
69293.ENSGACP00000005266 ENSGACP00000005266 ENSGACP00000005266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]