SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005268 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005268
Domain Number 1 Region: 135-255
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-39
Family Second domain of FERM 0.00000178
Further Details:      
 
Domain Number 2 Region: 256-364
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-36
Family Third domain of FERM 0.00000461
Further Details:      
 
Domain Number 3 Region: 34-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.3e-34
Family First domain of FERM 0.0000255
Further Details:      
 
Domain Number 4 Region: 415-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000176
Family Protein kinases, catalytic subunit 0.0000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005268   Gene: ENSGACG00000004011   Transcript: ENSGACT00000005283
Sequence length 502
Comment pep:known_by_projection group:BROADS1:groupX:6131463:6151531:-1 gene:ENSGACG00000004011 transcript:ENSGACT00000005283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAYLDPNLNHALLGGAKSRLSAGGSDRTMAGSVDRVLKVFHHFEANTEHSCWSSNIRY
GDATDVKGIIQKILDIHKVRWTSCFGLRLSNSQSRDQVHWLHPDLGVSHVREMYDQARST
EEWRYELRIRYLPKGFVQQFTEDKPTLNYFYQQVKNDYMTEIVEQVEQVALKLGCLEIRR
FFKEMRGNALDKKSNYELLEKDVGLRRFFPKDLLDSVKAKTLRKLIQQTFKQVANLNDEQ
CILKFLEILAPIHRYDKECFKCALGSSWVIQVELAIGPEEGISYLTDKGSTPTHLANFNQ
VQSIQYSAMEEKDRKGMLQLNVAGAAEPLTVTTASLTMAENLADLIDGYCRLISMETHSF
IVRYQKEGERALPSIPKLTNNEKKLEAVRSGVRAISVSETDDYAEIVDEEDTYTMPSTRD
YEIQRDRIELGRCIGEGQFGDVHQGVYDSPVCGKTHVHKHSSALLTMRQFDHPHIVKLIG
VITENPVWIIMELCTLGEVRPR
Download sequence
Identical sequences G3NIV8
ENSGACP00000005268 ENSGACP00000005268 69293.ENSGACP00000005268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]