SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005271 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005271
Domain Number 1 Region: 295-422
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-29
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 2 Region: 424-527
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-23
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 3 Region: 66-161
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000101
Family PDZ domain 0.015
Further Details:      
 
Domain Number 4 Region: 206-289
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000749
Family Ras-binding domain, RBD 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005271   Gene: ENSGACG00000004014   Transcript: ENSGACT00000005286
Sequence length 1260
Comment pep:known_by_projection group:BROADS1:groupXVI:8929582:8950765:-1 gene:ENSGACG00000004014 transcript:ENSGACT00000005286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARMDVFSFVKMPKLSGHRTKSSGWPPPSGTWSASQGPPNGWDMGTNREGRDCYINSVSQ
SSSLDEVRLDGDRFVPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGRLIPG
DEIMMINDEPVSSAPRERVIDLVRSCKESILLSVVQPYPSPKSAFISAAKKAKLKTNPVK
VRFAEEVIINGQVPETMKDNSLLFMPNVLKVYLENGQTKSFKFDSSTSIKDVILTLQEKL
SIKSIEHFSLMLEQRAEGSASKPMLLHEQEMLTQVTQRPGSQKMKCFFRLTFVPKDPLDL
LRRDAVAFEYLYVQSCNDVVLERFGSELKYDTALHLAALQMYILTINTKQSQKVSLKYIE
KEWGLALFLPPAVLSSMKEKNIKKALTHILKTNQNLVPPGKKLTALQAKVHYLKYLSDLR
LYGGRVFKSTLIQGEKHTEVTLLVGPKYGISHVINTKTNLVALLADFSHVNRIEMYTEDD
NRVRVELHVLDVKPITLLMESADAMNLACLTAGYYKLLVDSRRSIFNVAKNTNTSRPENK
PANCFWFLFAGHASRVKQPYQAIECTYSTPHKGLQDRNNQRCSQDYSDQEYLEHGKFEEI
HQAQHSIHMAERAECCRIPCTQTYLNVPRPKPQDSSRGAKVSFIFGDPTFDSVNPQNLGY
QRLMDETPEILDSHGHMYRRLEEDYKMMDAIEDGDGYQYSTKIFGPTECIEEPLLHDICY
AETTDEAEDEDDISCEEDMVMSDIDKPTLLSLSGSSDDIIDLTSLPPPPEGNDEEDNDVL
LHSLNLAIAAPPPGFRDSSDEEEQQQQQGAGNRAQGACNDIPVSLIDSVPNLGAEDHEEP
LNDAVVSTLQALEALAASEEQSAAPSTGVEISRAFSPDSSDSGNETNSSEMTESSELATA
QRHSENHLRMHAAVAEGYHAANEEKTRAAAAPGDGAPGAGRRNPQEQQDGEAKSSAVASS
HILHSDGGEMEPETMEMKSVSEYFTKMHLDSVMSRQGGKQREADTCESSNRSDVAPRDSP
RDESPHLVGKYNAFTVRDSYYMNQLDLGRTHFKDGHQKWQQRAPGNKMPDHLDPQASHAD
KLTVKGEKRDSSEGSQQSSDRLRSPCKAAALAEGEAASQDNEQQQIKIPPSERDVTQSRE
YKVSKRMSSIQSEGAHPLHGSQCSSIDAGCSTGSSSCATPMDSPLCATDNMHVLSESSLK
GLSYATAQDKAFGPPGEGRAGHSVDPTLPRKTHAATSGEPGFGTTRDGGHRKPKIKETTG
Download sequence
Identical sequences G3NIW1
ENSGACP00000005271 ENSGACP00000005271 69293.ENSGACP00000005271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]