SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005279 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005279
Domain Number 1 Region: 573-702
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-29
Family Synaptotagmin-like (S variant) 0.00000511
Further Details:      
 
Domain Number 2 Region: 1388-1508
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.1e-24
Family Synaptotagmin-like (S variant) 0.0062
Further Details:      
 
Domain Number 3 Region: 414-534
Classification Level Classification E-value
Superfamily PDZ domain-like 1.86e-18
Family PDZ domain 0.0000588
Further Details:      
 
Domain Number 4 Region: 19-96
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.32e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005279   Gene: ENSGACG00000004016   Transcript: ENSGACT00000005294
Sequence length 1537
Comment pep:known_by_projection group:BROADS1:groupVI:4275285:4319906:1 gene:ENSGACG00000004016 transcript:ENSGACT00000005294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQQQLSSYRETVVRQATVAAGHRDDAPTCGICHKTKFADGCGNLCSYCQTKFCARCGGRV
SLRSNTEDKVVIWVCNNCRKQQELLTKPGEWFTGPAGKPAGLGSAISEPSVCQTLGDKKL
RSRSQAPPGSNPVIQEPNRPGVPGAAPGTDARSRSEPPRDSDCSPGESGRGGGGAGRGER
RQGQPNFKPRCPWTGTSRWESRERRESRKLSKGRSLEHDPVGGVGGVMRTEEGGYHHMDH
SGAPPRQAGPAPPGGRGHPAPALGRGGGMGGEVGDGVRTGQRTVGGVGGPREHNLAQQPL
PPELREPLGQGPVGRRTKREKSDSMLRNDSLSSDQSESLRPPPPRPYKSKRGMGAGGKRQ
TSVSSSEEEGGTTPEYSSCEDAEIESVSERGDWECYPHDPTGWHSLLPSPLSQHPVTWQP
SKEGDHLIGRITLSKRSATMPKEAGALLGLKVVGGRITESGRLGAFITKVKKGSLADVVG
HLRAGDEVLQWNGKLLPGATMKEVYNIILESQAEPQVELVVSRPIGDIPRIPDTSHPPLE
SSSSSFESQKMERPSLNVLSPSSPGMLQDAPQLMPGQLSVKLWYDKVGHQLIVNVLQATE
LHLRPDGRPRSPYVKMYFLPDRSDKSKRRTKTMKKTCEPKWNQTFVYPHVHRRDFRNHML
ELTIWDQPRSPDEDSTFMGEILIELETALLDDKPHWYPLQTHDVSSIPLPRPSPYLPRRL
TEPHGKKLQRSQRVREPEFDEGTAVMSKADGRGRERQRESTSTLEVPDQQRTPAHHIRSR
SVSPHREEQGRTRSRPPNVPAQRSLDDELPHARRSRSPTRHYDAVRGRRHEDEYLDDSNH
SEVIMIHQSMRGKSAECLHTRRSTRHNNTLPPKMPLLFNGTKRTNRYYNSSLPPACRKIS
AAAGSRVVVATRRSITTHRIVMFTDEVTVGDLQPSLDRVRSASANCLTPNIHAPSSETER
CTHRKPFSHSLPRRRPASPRILIQHASPEDDRFPKKSPASCLLKMTTSITAWPLFPVFPI
VKAASDPGDARVPHSWQRAPRQWQSSRPHLSSLLSLPACCCFHSVLRGLGLPPSPPLLSC
IRGHLQGGASLSSSVTSSSNRRVRQLPQLPPKSSTVEQVCVCVCVALVAEECVRQLQMRV
HSNRASAATTSSQQDLDRALKNKRELYKDQRRSTENVSHKSSDSDVSDVSAISRTSSASR
LSSTSYMSIQSERPRGRFSFGLTHMIGRAMRATGRHMLKSTSVSGEIYGMEHVDGSQSDT
ALGSGIKKRRSSLSQRVVAILPSRRSRSTSQLSQTGKKVGKGGSSSIQRSVETGMAVEYP
RGGSSMNRQASRESTDGSMNSYSSEGNLIFSGMRLGADSQFSDFLDGLGPGQLVGRQTLA
TPAMGDVQIGLMDKKGQLEVEVIRARGLTSKPGSKSLPAPYVKVYLLDTGTCKAKKKTKI
ARKTLEPLYQQHLLFEESPQGKVLQVIVWGDYGRLDHKCFMGVAQILLEELDLSSTVIGW
YKLFPPSSLVDPTLAPLTRLASQTSLDSSGPPPGVRS
Download sequence
Identical sequences G3NIW9
69293.ENSGACP00000005279 ENSGACP00000005279 ENSGACP00000005279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]