SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005296 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005296
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily PH domain-like 5.14e-27
Family Phosphotyrosine-binding domain (PTB) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005296   Gene: ENSGACG00000004040   Transcript: ENSGACT00000005311
Sequence length 174
Comment pep:novel group:BROADS1:groupXII:3116439:3118541:-1 gene:ENSGACG00000004040 transcript:ENSGACT00000005311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSSEEDNEISFPVKFLGRVEVVRPDGLQVLSEAVQGLKTPQGDMSKNAAKKSKVLLFL
SRDALDVLEKKTKYMLYTCPLSTVSFCAVLPSSPKVFGFVARHPAADASHCYVFQSRALS
HVLVSAIGEAFRASRKEEGVGVGRDLIVEALRLKNKMLQRENAELKDKLANSKP
Download sequence
Identical sequences G3NIY6
ENSGACP00000005296 69293.ENSGACP00000005296 ENSGACP00000005296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]