SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005392 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005392
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-42
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000166
Further Details:      
 
Domain Number 2 Region: 460-493
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0000000127
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005392   Gene: ENSGACG00000004100   Transcript: ENSGACT00000005407
Sequence length 496
Comment pep:known_by_projection group:BROADS1:groupXVIII:313994:349188:-1 gene:ENSGACG00000004100 transcript:ENSGACT00000005407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNAFRVVGRKIQDHQVVI
NCAIPKGLKYNQATPTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQDTGPTV
PRQNPQVQNGPTPEEMELQRRVCSEDQVLSELTGTSDRGRLSRATLEGIHQERPSGPGET
QRARRDPAGRERPSGPGETQRTRRDPAGQERPSGPGETQRAGRDPADQLLARTWKHQQML
CTLSHVHVRDATPLTRAGPYGPSGLPSIHAPFPGSVSQSGRPLSPAGRQLSPDLRVSGDS
AQLSLVADPQNPNGGRKQGCVQNPDHRPLYQFLFILRRRLTRIPSRGLSRVSIGGSYSSL
LLSGNRRDIEACGGNRLMEEMSALLARRRRIAEKGSSPEPDQRSEEGEINTTPKVSACST
PDTARKPWDRTNTLNGSKSPVIGRYAFFPPLSYLVEGKCLDTREDDILDEMRKELSKLKE
ELIDAIREELGRSSSA
Download sequence
Identical sequences G3NJ81
ENSGACP00000005392 69293.ENSGACP00000005392 ENSGACP00000005392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]