SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005440 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005440
Domain Number 1 Region: 9-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-61
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005440
Domain Number - Region: 294-356
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000444
Family Ubiquitin-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005440   Gene: ENSGACG00000004136   Transcript: ENSGACT00000005456
Sequence length 742
Comment pep:known_by_projection group:BROADS1:groupXIII:1556748:1571244:-1 gene:ENSGACG00000004136 transcript:ENSGACT00000005456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRVTLQQQSCGSWELKERLGTGGFGNVTRWQNKDTEEQISIKQCRQELSERNKERWVLE
IQIMKRLDHINVVAAREVPEGMQEMITTNDLPLLAMEYCQGGDLRKHLNLLENCCGMREG
SVLILLRDISSALTYLHKKRIIHRDLKPENIVLQHGEKRLIHKIIDLGYAKELDQSSLCT
SFVGTLQYLAPELIEREKYTVTVDYWSFGTLVFECITGFRPFLPTWQPIPWHNKLRTKQK
DDIVVYEDLTGEVHFSKHLPQPNDLNSLLSERLERWLQLMLKWCPQERGKDPNATPSDCF
SQLEVILQLKLVHVLNMISAKILTYSVSEEETVADLQLRIEKDSNIPATNQELLLEAGLA
LEPHGLATQCAVDYTEIDGRRTDSPLVFLFDRSSCSYEPQFAPRTLPENIRFIQTCHKPI
LAYSPLRRTCGQAWHTIRSLKDDWQRLQQGQKAAIMSLLRYNSSLSKQKNEMVSMHQRLM
AKLDFFTTSLHIDVDKYQEQTATGIASEKLMGVWREMEQTAVSCGQAKVSELEEEMMQLQ
PDIVDVQRQPWRSGEALDTLEGKAMELFRKLREKPRDQRLPGDSQEVVRLVLQAVQFYER
KLRDFYTHLSKTAVCRQRVMELLPKVEGMVQSMVESEQVLMSLQERRQRELWNLLKVACS
KVRSPVSGSPDGLPTPSSVPPLLTPRHSLQQFDESLVEESRTFEGRLQSLLHDTIQDSQS
SMEVLREWTWLHSSQNFSSDLS
Download sequence
Identical sequences G3NJC9
ENSGACP00000005440 ENSGACP00000005440 69293.ENSGACP00000005440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]