SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005477 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005477
Domain Number 1 Region: 1401-1517
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-35
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 2 Region: 1131-1195
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.93e-18
Family PHD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005477   Gene: ENSGACG00000004158   Transcript: ENSGACT00000005493
Sequence length 1534
Comment pep:known_by_projection group:BROADS1:groupXV:172779:187690:-1 gene:ENSGACG00000004158 transcript:ENSGACT00000005493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLHRRAFVRQRPPADLRPDEEVFLCKITHEIFRSYDEFFERTILCNSLVWSCSLTGRT
GLTYLEATDSERRARLSLQSFSVSLLHPLLHLAAHSRCCRLTELCEVVYAFVKDRFFPGE
TVDVVGRNGARHVCEILQVLSPHSSANGRSKPSGGDAIVISDSDEESEAFQSPTVNGRKK
RKKKPLSPSVFKYMVRMMKAEHSEPFTVKANHISRRKTSVSKERLKLLFKQHCEPQNGTI
VLKSSTVTKYRLSEQSFSQFFPDEPPLFPFSPPAKGGRGSPGQCFPGSQPADVGDTRCPR
MCPSGQTRMDNFFVPPMRSTSHLSQRATLKKTLQNCLQASSSLSKAAEEKLKLLQQKDDM
AAAAKDRVRHDIMRRVALQEREKLKEEKKKYAERLKLWSKPREDMECEDLRELPSPVPVR
TRLPPHLFGEALMVLEFLRAFGEVLALKDEFPEGVSLEVLEEALVGSDPEGPLCELLFFF
LSAIFQALDEEQEDVAKEQAEGPPPPHLPEALDDDHDATQSALSAVASLAASWPQLHQGC
GLKQLDLDSCTLSEILRLHILASGAGCYHGNAKFRYQKQGGFTLMDDPCVELRLAEPLLL
KRLTSTSVYDLTPEEKLRILKALMGKLLTLASSRDLIEDCVEDQRSAKQELREIRSEQHR
RDREEAALRVRLRLKRTLNATEKKSAFLIKVSKPGEVNYSSVSSPYSRDKSMDKDAAVQS
RGREVRVILGPDGLLKEGPDHRWDTAGMKGKVNNSGGRRGAKVFIQQADVNQIDNQPTSD
PKPLPCPPTLLSAKEQEKVRELQQRIQKAASCTCLLPLGRDRLYRRYWLLPSASTLFVEE
DGFGLTEDMLRPRPRPAQDAPATVEEELSQGSSKYYLNISSLDSAGTSPTPFSTCGPPVK
CLNQWFFYTSMEEVDLLIEALNPRGHRESGLREALLQERDKLTHLMQSCDRTKYSSTDDL
ECRSVPEWTSAAEHVMEGRLRDLLLDIEDRIHQGTLGTLKVMDRRVWRSALGAGNYELLC
SDGRMNARVDPTEVDSPVHLRVRDRLQELRSDSGSVAASSGGGTPQLVSSSVRILAQALS
HIEQGIERRFIKAPLDGSDSGRVIKTVLERWRESLQICTSLSQVFVHLSSLERSVLWSRS
VLNARCRICRRKGDADNMLLCDSCDRGHHTHCLRPRLKAVPEGDWFCPDCRPKQRSSRLP
SRQRSSIDEDEEETDSGSITMVTDSGSITKETRSFYRLLPHDDAGRHGFGYILIKTYTHT
HTLPFKSLGSLRNVLIFQSTELIFTLFNSPSQLNLPHVALSCEIRAHAHRPAEGPPTPSQ
GSKAPARSGSRLSARLSHEILATNTKTSLAQPEPLKRQPKGKYTPGYPDQSTGKTRHTSR
FHSAPPTEVAPPPKPSRPVLPPSSSSTRRSSGRNNGVHELSACEQLTVGLVRHEDSWPFM
KLVSRTQVPDYYDIVKKPIALSTIREKVNNCEYQTAGEFVSDVDLMFSNCLQYNPRHTNE
AKAGHRLQQFFYSELSRLGLSEQGATPPAKRSRY
Download sequence
Identical sequences G3NJG6
69293.ENSGACP00000005477 ENSGACP00000005477 ENSGACP00000005477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]