SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000005498 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000005498
Domain Number 1 Region: 225-417
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.32e-25
Family Ankyrin repeat 0.00092
Further Details:      
 
Domain Number 2 Region: 520-634
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000301
Family Second domain of FERM 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000005498
Domain Number - Region: 421-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.03
Family Ras-binding domain, RBD 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000005498   Gene: ENSGACG00000004168   Transcript: ENSGACT00000005514
Sequence length 742
Comment pep:known_by_projection group:BROADS1:groupX:6449080:6474821:-1 gene:ENSGACG00000004168 transcript:ENSGACT00000005514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNEDALEDVFVAVIRPKSQASLNSKEYRAKAYEIVLIEVPLEGKEKKRKKVLLATKITA
AGDKSKSILDYVDKTIRPISNNQGFIGKRVVHMKKFPLDGKNEGEEASLFVVPVSAKDNS
KPVYSAGCPSFYCFQDIMRVCSETSAHFCPITSKMLLVLDKWLAEQHTVPHAIAALFRPA
PIERVKTNVSNPAYSSEGKQSEDGLHMGYTALEVKSKMMSLEKADMCVLNPLYGSDLQYT
NRVDKVVINPYFGLGAPDYSKIQIPKREKWQHGPNSVAEDKERQWVDDFPLHRSSCEGDT
ELLSKLLDSGLSVKQLDSDHWAPIHYACWHGKVEATKLLLEKGNCNPNLLNGQLSSPLHF
AARGGHVEIVQLLLQHPEIDRHIEDQQKRSPLQLCEENKQNEWEETVKLLQKCSSKPYEK
VRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQDTQQYFTIWICSENLHLQLKPYHKPL
QHLRIWTEIVTDLTLLDPQRETSQLFLRRDVRLPLDVEKKVEDPLAILILFDEARHCLLK
GFFPAPDTKLITLASLLLQIIYGSYESKKHKQGFLNEENLKSIVPISKVKSKAYHWTNRI
LHEYKALSTSEGVSKEMHHLQRLFLQNCWDIPTYGAAFFTGQVYTKASASNHKVIRVYVG
VNTKGLHLMNMETKVPLISLEYGTFMWQLGHADQYFQIHSGDNKMNFIVHTKQAGLIVKL
LMKLSGQMTPNDKSIMDKYAYG
Download sequence
Identical sequences G3NJI7
69293.ENSGACP00000005498 ENSGACP00000005498 ENSGACP00000005498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]